Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	414061
Gene name	DnaJ heat shock protein family (Hsp40) member B3
Gene symbol	DNAJB3
Synonyms (NCBI Gene)	HCG3
Chromosome	2
Chromosome location	2q37.1

miRTarBase ID	miRNA	Experiments
MIRT2679326	hsa-miR-136	CLIP-seq
MIRT2679327	hsa-miR-4436b-5p	CLIP-seq
MIRT2679328	hsa-miR-4691-5p	CLIP-seq

GO ID	Ontology	Definition	Evidence
GO:0005737	Component	Cytoplasm	IEA
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051087	Function	Protein-folding chaperone binding	IEA
GO:0090084	Process	Negative regulation of inclusion body assembly	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein name

DnaJ homolog subfamily B member 3

Protein function

May operate as a co-chaperone of the male germ cell- and haploid stage-specific Hsp70 proteins.

PDB

2EJ7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00226	DnaJ	3 → 66	DnaJ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in sperm (at protein level). {ECO:0000269|PubMed:18184612}.

Sequence

MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAK
KRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLE
NILGGSEELLGKQKQSVCTPFLCLQ

Sequence length

145

Interactions

View interactions

Related Genes Genes most often co-reported with DNAJB3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for DNAJB3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to DNAJB3 (see Related Genes above), that are NOT already directly curated for DNAJB3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to DNAJB3.

DNAJB3 (DnaJ heat shock protein family (Hsp40) member B3)