DMTN (dematin actin binding protein)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2039
• Gene name: Dematin actin binding protein
• Gene symbol: DMTN
• Synonyms (NCBI Gene): DMT, EPB49
• Chromosome: 8
• Chromosome location: 8p21.3
• Summary: The protein encoded by this gene is an actin binding and bundling protein that plays a structural role in erythrocytes, by stabilizing and attaching the spectrin/actin cytoskeleton to the erythrocyte membrane in a phosphorylation-dependent manner. This pr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023523	hsa-miR-1-3p	Microarray	18668037
MIRT046337	hsa-miR-23b-3p	CLASH	23622248
MIRT045524	hsa-miR-149-5p	CLASH	23622248
MIRT042375	hsa-miR-484	CLASH	23622248
MIRT038860	hsa-miR-93-3p	CLASH	23622248

Gene ontology (GO) Show/Hide all (69)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IDA	19241372, 22927433, 23355471
GO:0003779	Function	Actin binding	IEA
GO:0005102	Function	Signaling receptor binding	IDA	18347014
GO:0005515	Function	Protein binding	IPI	18347014, 23060452, 25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005790	Component	Smooth endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA	23060452
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IDA	22927433
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	23060452
GO:0005886	Component	Plasma membrane	IEA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007010	Process	Cytoskeleton organization	TAS	7615546
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IMP	10565303
GO:0010591	Process	Regulation of lamellipodium assembly	IMP	10565303
GO:0010763	Process	Positive regulation of fibroblast migration	IEA
GO:0010763	Process	Positive regulation of fibroblast migration	ISS
GO:0010801	Process	Negative regulation of peptidyl-threonine phosphorylation	ISS
GO:0010812	Process	Negative regulation of cell-substrate adhesion	IEA
GO:0010812	Process	Negative regulation of cell-substrate adhesion	ISS
GO:0012505	Component	Endomembrane system	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0014731	Component	Spectrin-associated cytoskeleton	IDA	22927433
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0015629	Component	Actin cytoskeleton	TAS	8341682
GO:0016020	Component	Membrane	IEA
GO:0030032	Process	Lamellipodium assembly	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030507	Function	Spectrin binding	IDA	22927433
GO:0030863	Component	Cortical cytoskeleton	IEA
GO:0031095	Component	Platelet dense tubular network membrane	IDA	23060452
GO:0031253	Component	Cell projection membrane	IEA
GO:0031253	Component	Cell projection membrane	ISS
GO:0031410	Component	Cytoplasmic vesicle	IDA	18347014
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	22927433
GO:0033137	Process	Negative regulation of peptidyl-serine phosphorylation	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048821	Process	Erythrocyte development	IEA
GO:0048821	Process	Erythrocyte development	ISS
GO:0050732	Process	Negative regulation of peptidyl-tyrosine phosphorylation	ISS
GO:0051015	Function	Actin filament binding	IBA
GO:0051017	Process	Actin filament bundle assembly	IDA	19241372, 23355471
GO:0051017	Process	Actin filament bundle assembly	TAS	7615546
GO:0051489	Process	Regulation of filopodium assembly	IMP	10565303
GO:0051563	Process	Smooth endoplasmic reticulum calcium ion homeostasis	IEA
GO:0051563	Process	Smooth endoplasmic reticulum calcium ion homeostasis	ISS
GO:0051693	Process	Actin filament capping	IEA
GO:0051895	Process	Negative regulation of focal adhesion assembly	IEA
GO:0051895	Process	Negative regulation of focal adhesion assembly	ISS
GO:0065003	Process	Protein-containing complex assembly	IDA	18347014
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0065003	Process	Protein-containing complex assembly	ISS
GO:0071320	Process	Cellular response to cAMP	IDA	22927433
GO:0071786	Process	Endoplasmic reticulum tubular network organization	IEA
GO:0071786	Process	Endoplasmic reticulum tubular network organization	ISS
GO:0090303	Process	Positive regulation of wound healing	IEA
GO:0090303	Process	Positive regulation of wound healing	ISS
GO:0090315	Process	Negative regulation of protein targeting to membrane	IEA
GO:0090315	Process	Negative regulation of protein targeting to membrane	ISS
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IEA
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	ISS

Other IDs

• MIM: 125305
• HGNC: 3382
• e!Ensembl: ENSG00000158856

Protein

• UniProt ID: Q08495
• Protein name: Dematin (Dematin actin-binding protein) (Erythrocyte membrane protein band 4.9)
• Protein function: Membrane-cytoskeleton-associated protein with F-actin-binding activity that induces F-actin bundles formation and stabilization. Its F-actin-bundling activity is reversibly regulated upon its phosphorylation by the cAMP-dependent protein kinase
• PDB: 1QZP , 1ZV6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02209	VHP	370 → 405	Villin headpiece domain	Domain
  PF16182	AbLIM_anchor	8 → 369	Putative adherens-junction anchoring region of AbLIM	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in platelets (at protein level). Expressed in heart, brain, lung, skeletal muscle, and kidney. {ECO:0000269|PubMed:23060452}.
• Sequence:

  MERLQKQPLTSPGSVSPSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPD
  LMIYEPHFTYSLLEHVELPRSRERSLSPKSTSPPPSPEVWADSRSPGIISQASAPRTTGT
  PRTSLPHFHHPETSRPDSNIYKKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPD
  PNQPAKIETDYWPCPPSLAVVETEWRKRKASRRGAEEEEEEEDDDSGEEMKALRERQREE
  LSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGTSKSSSLPAYGRTTLSR
  LQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVVTNKGRTKLPP
  GVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF

• Sequence length: 405

Pathways

Reactome Pathway:

Miscellaneous transport and binding events

Related Genes

No strongly related genes found yet for DMTN.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DMTN.