DMRTC2 (DMRT like family C2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 63946
• Gene name: DMRT like family C2
• Gene symbol: DMRTC2
• Synonyms (NCBI Gene): -
• Chromosome: 19
• Chromosome location: 19q13.2

miRNA Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT939232	hsa-miR-2110	CLIP-seq
MIRT939233	hsa-miR-3150a-3p	CLIP-seq
MIRT939234	hsa-miR-3167	CLIP-seq
MIRT939235	hsa-miR-335	CLIP-seq
MIRT939236	hsa-miR-4450	CLIP-seq
MIRT939237	hsa-miR-4753-3p	CLIP-seq
MIRT939238	hsa-miR-498	CLIP-seq
MIRT939239	hsa-miR-876-5p	CLIP-seq
MIRT2213216	hsa-miR-5096	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001741	Component	XY body	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007141	Process	Male meiosis I	IEA
GO:0007290	Process	Spermatid nucleus elongation	IEA
GO:0007548	Process	Sex differentiation	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070828	Process	Heterochromatin organization	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 614806
• HGNC: 13911
• e!Ensembl: ENSG00000142025

Protein

• UniProt ID: Q8IXT2
• Protein name: Doublesex- and mab-3-related transcription factor C2
• Protein function: May be involved in sexual development.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00751	DM	38 → 84	DM DNA binding domain	Family
  PF15791	DMRT-like	239 → 366	Doublesex-and mab-3-related transcription factor C1 and C2	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in testis and pancreas. {ECO:0000269|PubMed:11863363}.
• Sequence:

  MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRL
  CLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQP
  QVPSGKENIAPQPQTPHGAVLLAPTPPGKNSCGPLLLSHPPEASPLSWTPVPPGPWVPGH
  WLPPGFSMPPPVVCRLLYQEPAVSLPPFPGFDPGTSLQLPTHGPFTTCPGSHPVLTAPLS
  GEPQGPPSQPRTHSTLILQPCGTPDPLQLQPQASGASCLARTSGPSEWQLQQEAAEALVG
  LKDSSQAPRVTPSVPPNPAWISLLHPCGPPAPAGGRGFQPVGPCLRPSPAPSVALHIGRL
  GSISLLS

• Sequence length: 367

Related Genes

No strongly related genes found yet for DMRTC2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DMRTC2.