DLK2 (delta like non-canonical Notch ligand 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 65989
Gene name Delta like non-canonical Notch ligand 2
Gene symbol DLK2
Synonyms (NCBI Gene)
DLK-2EGFL9
Chromosome 6
Chromosome location 6p21.1
miRNA miRNA information provided by mirtarbase database.
8 Show/Hide all (8)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT938750 hsa-miR-1293 CLIP-seq
MIRT938751 hsa-miR-146a CLIP-seq
MIRT938752 hsa-miR-146b-5p CLIP-seq
MIRT938753 hsa-miR-3179 CLIP-seq
MIRT938754 hsa-miR-4483 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005112 Function Notch binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0016020 Component Membrane IEA
GO:0042802 Function Identical protein binding IEA
GO:0045598 Process Regulation of fat cell differentiation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
621120 21113 ENSG00000171462
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UY11
Protein name Protein delta homolog 2 (DLK-2) (Epidermal growth factor-like protein 9) (EGF-like protein 9)
Protein function Regulates adipogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00008 EGF 178 → 208 EGF-like domain Domain
PF00008 EGF 95 → 127 EGF-like domain Domain
PF00008 EGF 216 → 246 EGF-like domain Domain
PF12661 hEGF 142 → 166 Human growth factor-like EGF Domain
Sequence 
MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERC
VRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCL
PGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLM
RPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPS
GYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEA
GLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQV
SMLPAGLPLPRDLPPEPGKTTAL
Sequence length 383
Interactions View interactions

No strongly related genes found yet for DLK2.

No additional diseases found yet through genes similar to DLK2.