DIAPH2-AS1 (DIAPH2 antisense RNA 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 10824
Gene name DIAPH2 antisense RNA 1
Gene symbol DIAPH2-AS1
Synonyms (NCBI Gene)
EPAG
Chromosome X
Chromosome location Xq21.33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0007165 Process Signal transduction NAS 8133036
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300347 16972 ENSG00000236256
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14236
Protein name Early lymphoid activation gene protein (DIAPH2 antisense RNA 1) (DIAPH2 antisense gene protein 1)
Protein function May function as an early signal that helps mediate the activation of T-cells.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, kidney, lung, and skeletal muscle, with lower levels in pancreas and liver. {ECO:0000269|PubMed:8133036}.
Sequence 
MNLYLHPKLWPQLAGTKTLHVADAQRVRKITVHDGIWDAELPRAKRNHSYHLRYHGSSYS
RCFLERYRCKTIGVFRRSNQPDCLETRSEKAKNRDGVVQEKSVRTLFSECVNQCDIRRRP
TRFLRMFYHQKHFQLGLKGTETEKNERRL
Sequence length 149
Interactions View interactions

No strongly related genes found yet for DIAPH2-AS1.

No additional diseases found yet through genes similar to DIAPH2-AS1.