DHX29 (DExH-box helicase 29)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 54505
• Gene name: DExH-box helicase 29
• Gene symbol: DHX29
• Synonyms (NCBI Gene): DDX29
• Chromosome: 5
• Chromosome location: 5q11.2
• Summary: This gene encodes a member of the DEAH (Asp-Glu-Ala-His) subfamily of proteins, part of the DEAD (Asp-Glu-Ala-Asp) box family of RNA helicases. The encoded protein functions in translation initiation, and is specifically required for ribosomal scanning ac

miRNA Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT935319	hsa-miR-3647-3p	CLIP-seq
MIRT935320	hsa-miR-4666-5p	CLIP-seq
MIRT935321	hsa-miR-4789-5p	CLIP-seq
MIRT935322	hsa-miR-548a-5p	CLIP-seq
MIRT935323	hsa-miR-548ab	CLIP-seq
MIRT935324	hsa-miR-548ak	CLIP-seq
MIRT935325	hsa-miR-548b-5p	CLIP-seq
MIRT935326	hsa-miR-548c-5p	CLIP-seq
MIRT935327	hsa-miR-548d-5p	CLIP-seq
MIRT935328	hsa-miR-548h	CLIP-seq
MIRT935329	hsa-miR-548i	CLIP-seq
MIRT935330	hsa-miR-548j	CLIP-seq
MIRT935331	hsa-miR-548k	CLIP-seq
MIRT935332	hsa-miR-548l	CLIP-seq
MIRT935333	hsa-miR-548w	CLIP-seq
MIRT935334	hsa-miR-548y	CLIP-seq
MIRT935335	hsa-miR-559	CLIP-seq
MIRT2212242	hsa-miR-4422	CLIP-seq
MIRT2212243	hsa-miR-591	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001731	Process	Formation of translation preinitiation complex	IMP	23047696
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IBA
GO:0003724	Function	RNA helicase activity	IEA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0004386	Function	Helicase activity	IBA
GO:0004386	Function	Helicase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IEA
GO:0008494	Function	Translation activator activity	IMP	20018725
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IDA	23706745
GO:0016787	Function	Hydrolase activity	IEA
GO:0016818	Function	Hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0017111	Function	Ribonucleoside triphosphate phosphatase activity	IMP	23047696
GO:0022627	Component	Cytosolic small ribosomal subunit	IDA	20018725
GO:0042255	Process	Ribosome assembly	IMP	20018725
GO:0043024	Function	Ribosomal small subunit binding	IDA	23706745
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045727	Process	Positive regulation of translation	IEA
GO:0045948	Process	Positive regulation of translational initiation	IEA

Other IDs

• MIM: 612720
• HGNC: 15815
• e!Ensembl: ENSG00000067248

Protein

• UniProt ID: Q7Z478
• Protein name: ATP-dependent RNA helicase DHX29 (EC 3.6.4.13) (DEAH box protein 29) (Nucleic acid helicase DDXx)
• Protein function: ATP-binding RNA helicase involved in translation initiation. Part of the 43S pre-initiation complex that is required for efficient initiation on mRNAs of higher eukaryotes with structured 5'-UTRs by promoting efficient NTPase-dependent 48S compl
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00270	DEAD	575 → 744	DEAD/DEAH box helicase	Domain
  PF00271	Helicase_C	847 → 986	Helicase conserved C-terminal domain	Family
  PF04408	HA2	1049 → 1172	Helicase associated domain (HA2)	Domain
  PF07717	OB_NTP_bind	1216 → 1302	Oligonucleotide/oligosaccharide-binding (OB)-fold	Domain

• Sequence:

  MGGKNKKHKAPAAAVVRAAVSASRAKSAEAGIAGEAQSKKPVSRPATAAAAAAGSREPRV
  KQGPKIYSFNSTNDSSGPANLDKSILKVVINNKLEQRIIGVINEHKKQNNDKGMISGRLT
  AKKLQDLYMALQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFE
  EQQPKSRPKFQSPQIQATISPPLQPKTKTYEEDPKSKPKKEEKNMEVNMKEWILRYAEQQ
  NEEEKNENSKSLEEEEKFDPNERYLHLAAKLLDAKEQAATFKLEKNKQGQKEAQEKIRKF
  QREMETLEDHPVFNPAMKISHQQNERKKPPVATEGESALNFNLFEKSAAATEEEKDKKKE
  PHDVRNFDYTARSWTGKSPKQFLIDWVRKNLPKSPNPSFEKVPVGRYWKCRVRVIKSEDD
  VLVVCPTILTEDGMQAQHLGATLALYRLVKGQSVHQLLPPTYRDVWLEWSDAEKKREELN
  KMETNKPRDLFIAKLLNKLKQQQQQQQQHSENKRENSEDPEESWENLVSDEDFSALSLES
  ANVEDLEPVRNLFRKLQSTPKYQKLLKERQQLPVFKHRDSIVETLKRHRVVVVAGETGSG
  KSTQVPHFLLEDLLLNEWEASKCNIVCTQPRRISAVSLANRVCDELGCENGPGGRNSLCG
  YQIRMESRACESTRLLYCTTGVLLRKLQEDGLLSNVSHVIVDEVHERSVQSDFLLIILKE
  ILQKRSDLHLILMSATVDSEKFSTYFTHCPILRISGRSYPVEVFHLEDIIEETGFVLEKD
  SEYCQKFLEEEEEVTINVTSKAGGIKKYQEYIPVQTGAHADLNPFYQKYSSRTQHAILYM
  NPHKINLDLILELLAYLDKSPQFRNIEGAVLIFLPGLAHIQQLYDLLSNDRRFYSERYKV
  IALHSILSTQDQAAAFTLPPPGVRKIVLATNIAETGITIPDVVFVIDTGRTKENKYHESS
  QMSSLVETFVSKASALQRQGRAGRVRDGFCFRMYTRERFEGFMDYSVPEILRVPLEELCL
  HIMKCNLGSPEDFLSKALDPPQLQVISNAMNLLRKIGACELNEPKLTPLGQHLAALPVNV
  KIGKMLIFGAIFGCLDPVATLAAVMTEKSPFTTPIGRKDEADLAKSALAMADSDHLTIYN
  AYLGWKKARQEGGYRSEITYCRRNFLNRTSLLTLEDVKQELIKLVKAAGFSSSTTSTSWE
  GNRASQTLSFQEIALLKAVLVAGLYDNVGKIIYTKSVDVTEKLACIVETAQGKAQVHPSS
  VNRDLQTHGWLLYQEKIRYARVYLRETTLITPFPVLLFGGDIEVQHRERLLSIDGWIYFQ
  APVKIAVIFKQLRVLIDSVLRKKLENPKMSLENDKILQIITELIKTENN

• Sequence length: 1369

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Hepatocellular carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	not provided	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27983727	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27501049		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	27983727		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for DHX29.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DHX29.