DHRS7C (dehydrogenase/reductase 7C)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 201140
• Gene name: Dehydrogenase/reductase 7C
• Gene symbol: DHRS7C
• Synonyms (NCBI Gene): SDR32C2
• Chromosome: 17
• Chromosome location: 17p13.1

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	IEA
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IBA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0010880	Process	Regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IEA
GO:0010880	Process	Regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	ISS
GO:0014801	Component	Longitudinal sarcoplasmic reticulum	IEA
GO:0014801	Component	Longitudinal sarcoplasmic reticulum	ISS
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IBA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA
GO:0033017	Component	Sarcoplasmic reticulum membrane	IEA
GO:0033017	Component	Sarcoplasmic reticulum membrane	ISS
GO:0046323	Process	D-glucose import	IEA
GO:0046323	Process	D-glucose import	ISS

Other IDs

• MIM: 616161
• HGNC: 32423
• e!Ensembl: ENSG00000184544

Protein

• UniProt ID: A6NNS2
• Protein name: Dehydrogenase/reductase SDR family member 7C (EC 1.1.1.105) (Sarcoplasmic reticulum protein of 35 kDa) (Protein SRP-35) (Short-chain dehydrogenase/reductase family 32C member 2) (Protein SDR32C2)
• Protein function: NADH-dependent oxidoreductase which catalyzes the oxidation of all-trans-retinol to all-trans-retinal. Plays a role in the regulation of cardiac and skeletal muscle metabolic functions. Maintains Ca(2+) intracellular homeostasis by repressing Ca
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00106	adh_short	38 → 235	short chain dehydrogenase	Domain

• Sequence:

  MGVMAMLMLPLLLLGISGLLFIYQEVSRLWSKSAVQNKVVVITDAISGLGKECARVFHTG
  GARLVLCGKNWERLENLYDALISVADPSKQTFTPKLVLLDLSDISCVPDVAKEVLDCYGC
  VDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKALLPNMISRRTGQIVLVNNI
  QGKFGIPFRTTYAASKHAALGFFDCLRAEVEEYDVVISTVSPTFIRSYHVYPEQGNWEAS
  IWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIPKAAVYVRTFFPEFFFAVVAC
  GVKEKLNVPEEG

• Sequence length: 312

Related Genes

No strongly related genes found yet for DHRS7C.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DHRS7C.