Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	200895
Gene name	Dihydrofolate reductase 2
Gene symbol	DHFR2
Synonyms (NCBI Gene)	DHFRL1DHFRP4
Chromosome	3
Chromosome location	3q11.2

8 Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT694791	hsa-miR-1237-3p	HITS-CLIP	23313552
MIRT694790	hsa-miR-1248	HITS-CLIP	23313552
MIRT694789	hsa-miR-4490	HITS-CLIP	23313552
MIRT694788	hsa-miR-4774-5p	HITS-CLIP	23313552
MIRT694787	hsa-miR-629-5p	HITS-CLIP	23313552
MIRT694786	hsa-miR-4777-3p	HITS-CLIP	23313552
MIRT694785	hsa-miR-6868-3p	HITS-CLIP	23313552
MIRT694784	hsa-miR-6839-3p	HITS-CLIP	23313552

28 Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003729	Function	MRNA binding	IDA	21876184
GO:0004146	Function	Dihydrofolate reductase activity	IBA
GO:0004146	Function	Dihydrofolate reductase activity	IEA
GO:0004146	Function	Dihydrofolate reductase activity	IMP	21876188
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	21876184
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IMP	21876188
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	IMP	21876188
GO:0005829	Component	Cytosol	TAS
GO:0006730	Process	One-carbon metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0033560	Function	Folate reductase activity	TAS
GO:0046105	Process	Thymidine biosynthetic process	IDA	21876188
GO:0046452	Process	Dihydrofolate metabolic process	IBA
GO:0046653	Process	Tetrahydrofolate metabolic process	IDA	21876184
GO:0046653	Process	Tetrahydrofolate metabolic process	IEA
GO:0046654	Process	Tetrahydrofolate biosynthetic process	IBA
GO:0046654	Process	Tetrahydrofolate biosynthetic process	IEA
GO:0046655	Process	Folic acid metabolic process	IBA
GO:0046655	Process	Folic acid metabolic process	TAS
GO:0050661	Function	NADP binding	IBA
GO:0050661	Function	NADP binding	IEA

MIM	HGNC	e!Ensembl
616588	27309	ENSG00000178700

Q86XF0

Protein name

Dihydrofolate reductase 2, mitochondrial (Dihydrofolate reductase, mitochondrial) (EC 1.5.1.3) (Dihydrofolate reductase-like protein 1)

Protein function

Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR. {ECO:0000269|PubMed:21876184, ECO:0000269|PubMed:2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00186	DHFR_1	4 → 185	Dihydrofolate reductase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in numerous cell lines. {ECO:0000269|PubMed:21876184}.

Sequence

MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS
VYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKF
EVCEKDD

Sequence length

187

Interactions

View interactions

KEGG Pathway	Reactome Pathway
One carbon pool by folate	Metabolism of folate and pterines
Folate biosynthesis
Metabolic pathways
Biosynthesis of cofactors
Antifolate resistance
Folate transport and metabolism

DHFR2 (dihydrofolate reductase 2)

Save This Analysis