DENND10 (DENN domain containing 10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 404636
• Gene name: DENN domain containing 10
• Gene symbol: DENND10
• Synonyms (NCBI Gene): FAM45A
• Chromosome: 10
• Chromosome location: 10q26.11

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	30771381
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005515	Function	Protein binding	IPI	33961781, 35271311, 37172566
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IBA
GO:0005770	Component	Late endosome	IDA	30771381
GO:0005770	Component	Late endosome	IEA
GO:0015031	Process	Protein transport	IBA
GO:0015031	Process	Protein transport	IMP	30771381
GO:0031267	Function	Small GTPase binding	IBA
GO:0031267	Function	Small GTPase binding	IPI	30771381
GO:0032509	Process	Endosome transport via multivesicular body sorting pathway	IMP	30771381
GO:2000641	Process	Regulation of early endosome to late endosome transport	IBA
GO:2000641	Process	Regulation of early endosome to late endosome transport	IMP	30771381

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8TCE6
• Protein name: DENN domain-containing protein 10 (Protein FAM45A)
• Protein function: Guanine nucleotide exchange factor (GEF) regulating homeostasis of late endocytic pathway, including endosomal positioning, maturation and secretion, possibly through activating Rab proteins such as RAB27A and RAB27B (PubMed:38459129). Promotes
• PDB: 8P0V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08616	SPA	157 → 264		Family

• Sequence:

  MAAAEVADTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFV
  FGQYRRTWFYITTIEVPDSSILKKVTHFSIVLTAKDFNPEKYAAFTRILCRMYLKHGSPV
  KMMESYIAVLTKGICQSEENGSFLSKDFDARKAYLAGSIKDIVSQFGMETVILHTALMLK
  KRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYVHLNADELEALQMCTGYVAGFVDL
  EVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESHVIQD
  IALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAAAEQMLKI

• Sequence length: 357

Related Genes

No strongly related genes found yet for DENND10.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DENND10.