DEFB133 (defensin beta 133 (pseudogene))

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 403339
Gene name Defensin beta 133 (pseudogene)
Gene symbol DEFB133
Synonyms (NCBI Gene)
DEFB134
Chromosome 6
Chromosome location 6p12.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0006952 Process Defense response IEA
GO:0031731 Function CCR6 chemokine receptor binding IBA
GO:0042056 Function Chemoattractant activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q30KQ1
Protein name Beta-defensin 133 (Defensin, beta 133)
Protein function Has antibacterial activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13841 Defensin_beta_2 30 → 60 Beta defensin Domain
Sequence 
MKIHVFLFVLFFFLVPIATRVKCAVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCY
M
Sequence length 61
Interactions View interactions

No strongly related genes found yet for DEFB133.

No additional diseases found yet through genes similar to DEFB133.