DEFB109B (defensin beta 109B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 641517
Gene name Defensin beta 109B
Gene symbol DEFB109B
Synonyms (NCBI Gene)
DEF109P1BDEFB-109DEFB109DEFB109P1BHBD9
Chromosome 8
Chromosome location 8p23.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0006952 Process Defense response IEA
GO:0031731 Function CCR6 chemokine receptor binding IBA
GO:0042056 Function Chemoattractant activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q30KR1
Protein name Beta-defensin 109B (DEFB-109) (HBD9) (Defensin beta 109B)
Protein function Has antibacterial activity.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Constitutively expressed in all regions of the ocular surface with predominant expression in the uppermost layers of the corneal epithelium and lower levels in basal layers (at protein level) (PubMed:20375350). Also detected in some ke
Sequence 
MRLHLLLLILLLFSILLSPVRGGLGPAEGHCLNLFGVCRTDVCNIVEDQIGACRRRMKCC
RAWWILMPIPTPLIMSDYQEPLKPNLK
Sequence length 87
Interactions View interactions

No strongly related genes found yet for DEFB109B.

No additional diseases found yet through genes similar to DEFB109B.