DEFB108A (defensin beta 108A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 503694
Gene name Defensin beta 108A
Gene symbol DEFB108A
Synonyms (NCBI Gene)
BD-8DEFB-8DEFB108DEFB108BDEFB108P1DEFB8hBD-8
Chromosome 8
Chromosome location 8p23.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0006952 Process Defense response IEA
GO:0042742 Process Defense response to bacterium IEA
GO:0045087 Process Innate immune response IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 18089 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MXU0
Protein name Putative beta-defensin 108A (Defensin, beta 108A) (Defensin, beta 108C) (Putative beta-defensin 108B pseudogene 1/2)
Protein function Has antibacterial activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13841 Defensin_beta_2 27 → 56 Beta defensin Domain
Sequence 
MRIAVLFFTIFFFMSQVLPAKGKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLG
HQPRIESTTPKKD
Sequence length 73
Interactions View interactions

No strongly related genes found yet for DEFB108A.

No additional diseases found yet through genes similar to DEFB108A.