Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	1634
Gene name	Decorin
Gene symbol	DCN
Synonyms (NCBI Gene)	CSCDDSPG2PG40PGIIPGS2SLRR1B
Chromosome	12
Chromosome location	12q21.33
Summary	This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature prot

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs80338741	A>-	Pathogenic	Frameshift variant, coding sequence variant, 3 prime UTR variant
rs80338742	G>-	Pathogenic	Frameshift variant, coding sequence variant, 3 prime UTR variant
rs397515545	C>-	Pathogenic	Frameshift variant, coding sequence variant, 3 prime UTR variant
rs587777258	T>-	Pathogenic	Coding sequence variant, frameshift variant, 3 prime UTR variant

310

Show/Hide all (310)

miRTarBase ID	miRNA	Experiments
MIRT926407	hsa-miR-3647-3p	CLIP-seq
MIRT926408	hsa-miR-4766-5p	CLIP-seq
MIRT926409	hsa-miR-4282	CLIP-seq
MIRT926410	hsa-miR-4698	CLIP-seq
MIRT926411	hsa-miR-548c-3p	CLIP-seq
MIRT1547869	hsa-miR-1256	CLIP-seq
MIRT1547870	hsa-miR-1271	CLIP-seq
MIRT1547871	hsa-miR-182	CLIP-seq
MIRT1547872	hsa-miR-374c	CLIP-seq
MIRT1547873	hsa-miR-4255	CLIP-seq
MIRT1547874	hsa-miR-4450	CLIP-seq
MIRT1547875	hsa-miR-4642	CLIP-seq
MIRT1547876	hsa-miR-4797-5p	CLIP-seq
MIRT1547877	hsa-miR-655	CLIP-seq
MIRT1547878	hsa-miR-96	CLIP-seq
MIRT1974474	hsa-miR-4464	CLIP-seq
MIRT1974475	hsa-miR-4748	CLIP-seq
MIRT2428134	hsa-miR-105	CLIP-seq
MIRT2428135	hsa-miR-1202	CLIP-seq
MIRT2428136	hsa-miR-1207-5p	CLIP-seq
MIRT1547869	hsa-miR-1256	CLIP-seq
MIRT1547870	hsa-miR-1271	CLIP-seq
MIRT2428137	hsa-miR-1343	CLIP-seq
MIRT2428138	hsa-miR-145	CLIP-seq
MIRT2428139	hsa-miR-154	CLIP-seq
MIRT2428140	hsa-miR-181a	CLIP-seq
MIRT2428141	hsa-miR-181b	CLIP-seq
MIRT2428142	hsa-miR-181c	CLIP-seq
MIRT2428143	hsa-miR-181d	CLIP-seq
MIRT1547871	hsa-miR-182	CLIP-seq
MIRT2428144	hsa-miR-224	CLIP-seq
MIRT2428145	hsa-miR-2467-5p	CLIP-seq
MIRT2428146	hsa-miR-299-3p	CLIP-seq
MIRT2428147	hsa-miR-3074-5p	CLIP-seq
MIRT2428148	hsa-miR-3145-5p	CLIP-seq
MIRT2428149	hsa-miR-3163	CLIP-seq
MIRT2428150	hsa-miR-3180-5p	CLIP-seq
MIRT2428151	hsa-miR-3188	CLIP-seq
MIRT2428152	hsa-miR-340	CLIP-seq
MIRT2428153	hsa-miR-3591-5p	CLIP-seq
MIRT2428154	hsa-miR-3606	CLIP-seq
MIRT2428155	hsa-miR-3607-5p	CLIP-seq
MIRT926407	hsa-miR-3647-3p	CLIP-seq
MIRT2428156	hsa-miR-3671	CLIP-seq
MIRT2428157	hsa-miR-3690	CLIP-seq
MIRT2428158	hsa-miR-371-5p	CLIP-seq
MIRT2428159	hsa-miR-371b-5p	CLIP-seq
MIRT1547872	hsa-miR-374c	CLIP-seq
MIRT2428160	hsa-miR-3972	CLIP-seq
MIRT2428161	hsa-miR-3975	CLIP-seq
MIRT2428162	hsa-miR-421	CLIP-seq
MIRT2428163	hsa-miR-4254	CLIP-seq
MIRT1547873	hsa-miR-4255	CLIP-seq
MIRT2428164	hsa-miR-4262	CLIP-seq
MIRT926409	hsa-miR-4282	CLIP-seq
MIRT1547874	hsa-miR-4450	CLIP-seq
MIRT1974474	hsa-miR-4464	CLIP-seq
MIRT1547875	hsa-miR-4642	CLIP-seq
MIRT2428165	hsa-miR-4699-3p	CLIP-seq
MIRT2428166	hsa-miR-4709-5p	CLIP-seq
MIRT2428167	hsa-miR-4712-5p	CLIP-seq
MIRT2428168	hsa-miR-4736	CLIP-seq
MIRT2428169	hsa-miR-4742-5p	CLIP-seq
MIRT1974475	hsa-miR-4748	CLIP-seq
MIRT2428170	hsa-miR-4755-3p	CLIP-seq
MIRT2428171	hsa-miR-4763-3p	CLIP-seq
MIRT926408	hsa-miR-4766-5p	CLIP-seq
MIRT2428172	hsa-miR-4776-3p	CLIP-seq
MIRT1547876	hsa-miR-4797-5p	CLIP-seq
MIRT2428173	hsa-miR-485-5p	CLIP-seq
MIRT2428174	hsa-miR-508-5p	CLIP-seq
MIRT2428175	hsa-miR-513a-3p	CLIP-seq
MIRT926411	hsa-miR-548c-3p	CLIP-seq
MIRT2428176	hsa-miR-555	CLIP-seq
MIRT2428177	hsa-miR-556-5p	CLIP-seq
MIRT2428178	hsa-miR-590-3p	CLIP-seq
MIRT2428179	hsa-miR-607	CLIP-seq
MIRT2428180	hsa-miR-610	CLIP-seq
MIRT1547877	hsa-miR-655	CLIP-seq
MIRT2428181	hsa-miR-770-5p	CLIP-seq
MIRT2428182	hsa-miR-875-3p	CLIP-seq
MIRT2428183	hsa-miR-921	CLIP-seq
MIRT1547878	hsa-miR-96	CLIP-seq
MIRT2513724	hsa-let-7a	CLIP-seq
MIRT2513725	hsa-let-7b	CLIP-seq
MIRT2513726	hsa-let-7c	CLIP-seq
MIRT2513727	hsa-let-7d	CLIP-seq
MIRT2513728	hsa-let-7e	CLIP-seq
MIRT2513729	hsa-let-7f	CLIP-seq
MIRT2513730	hsa-let-7g	CLIP-seq
MIRT2513731	hsa-let-7i	CLIP-seq
MIRT2513732	hsa-miR-103b	CLIP-seq
MIRT2428134	hsa-miR-105	CLIP-seq
MIRT2428135	hsa-miR-1202	CLIP-seq
MIRT2428136	hsa-miR-1207-5p	CLIP-seq
MIRT2513733	hsa-miR-1251	CLIP-seq
MIRT1547869	hsa-miR-1256	CLIP-seq
MIRT1547870	hsa-miR-1271	CLIP-seq
MIRT2513734	hsa-miR-1321	CLIP-seq
MIRT2428137	hsa-miR-1343	CLIP-seq
MIRT2428139	hsa-miR-154	CLIP-seq
MIRT2428140	hsa-miR-181a	CLIP-seq
MIRT2428141	hsa-miR-181b	CLIP-seq
MIRT2428142	hsa-miR-181c	CLIP-seq
MIRT2428143	hsa-miR-181d	CLIP-seq
MIRT1547871	hsa-miR-182	CLIP-seq
MIRT2513735	hsa-miR-2113	CLIP-seq
MIRT2513736	hsa-miR-2117	CLIP-seq
MIRT2513737	hsa-miR-218	CLIP-seq
MIRT2428145	hsa-miR-2467-5p	CLIP-seq
MIRT2428147	hsa-miR-3074-5p	CLIP-seq
MIRT2513738	hsa-miR-3143	CLIP-seq
MIRT2428148	hsa-miR-3145-5p	CLIP-seq
MIRT2513739	hsa-miR-3158-3p	CLIP-seq
MIRT2513740	hsa-miR-3160-5p	CLIP-seq
MIRT2513741	hsa-miR-3162-5p	CLIP-seq
MIRT2428149	hsa-miR-3163	CLIP-seq
MIRT2428151	hsa-miR-3188	CLIP-seq
MIRT2513742	hsa-miR-325	CLIP-seq
MIRT2428152	hsa-miR-340	CLIP-seq
MIRT2428153	hsa-miR-3591-5p	CLIP-seq
MIRT2428154	hsa-miR-3606	CLIP-seq
MIRT2513743	hsa-miR-3616-3p	CLIP-seq
MIRT926407	hsa-miR-3647-3p	CLIP-seq
MIRT2513744	hsa-miR-3662	CLIP-seq
MIRT2428156	hsa-miR-3671	CLIP-seq
MIRT2513745	hsa-miR-3675-3p	CLIP-seq
MIRT2428157	hsa-miR-3690	CLIP-seq
MIRT2428158	hsa-miR-371-5p	CLIP-seq
MIRT2428159	hsa-miR-371b-5p	CLIP-seq
MIRT1547872	hsa-miR-374c	CLIP-seq
MIRT2513746	hsa-miR-376c	CLIP-seq
MIRT2513747	hsa-miR-377	CLIP-seq
MIRT2513748	hsa-miR-3927	CLIP-seq
MIRT2428160	hsa-miR-3972	CLIP-seq
MIRT2428161	hsa-miR-3975	CLIP-seq
MIRT2428162	hsa-miR-421	CLIP-seq
MIRT2428163	hsa-miR-4254	CLIP-seq
MIRT1547873	hsa-miR-4255	CLIP-seq
MIRT2428164	hsa-miR-4262	CLIP-seq
MIRT2513749	hsa-miR-4277	CLIP-seq
MIRT926409	hsa-miR-4282	CLIP-seq
MIRT2513750	hsa-miR-4305	CLIP-seq
MIRT2513751	hsa-miR-4432	CLIP-seq
MIRT1547874	hsa-miR-4450	CLIP-seq
MIRT2513752	hsa-miR-4458	CLIP-seq
MIRT2513753	hsa-miR-4500	CLIP-seq
MIRT1547875	hsa-miR-4642	CLIP-seq
MIRT2513754	hsa-miR-4650-3p	CLIP-seq
MIRT2513755	hsa-miR-4662a-3p	CLIP-seq
MIRT2513756	hsa-miR-4684-5p	CLIP-seq
MIRT2428165	hsa-miR-4699-3p	CLIP-seq
MIRT2428166	hsa-miR-4709-5p	CLIP-seq
MIRT2513757	hsa-miR-4721	CLIP-seq
MIRT2428168	hsa-miR-4736	CLIP-seq
MIRT2513758	hsa-miR-4739	CLIP-seq
MIRT2428169	hsa-miR-4742-5p	CLIP-seq
MIRT2428170	hsa-miR-4755-3p	CLIP-seq
MIRT2513759	hsa-miR-4756-5p	CLIP-seq
MIRT2428171	hsa-miR-4763-3p	CLIP-seq
MIRT926408	hsa-miR-4766-5p	CLIP-seq
MIRT2428172	hsa-miR-4776-3p	CLIP-seq
MIRT1547876	hsa-miR-4797-5p	CLIP-seq
MIRT2428173	hsa-miR-485-5p	CLIP-seq
MIRT2513760	hsa-miR-489	CLIP-seq
MIRT2513761	hsa-miR-494	CLIP-seq
MIRT2428174	hsa-miR-508-5p	CLIP-seq
MIRT2513762	hsa-miR-526b	CLIP-seq
MIRT926411	hsa-miR-548c-3p	CLIP-seq
MIRT2428177	hsa-miR-556-5p	CLIP-seq
MIRT2513763	hsa-miR-578	CLIP-seq
MIRT2513764	hsa-miR-580	CLIP-seq
MIRT2428178	hsa-miR-590-3p	CLIP-seq
MIRT2428179	hsa-miR-607	CLIP-seq
MIRT2428180	hsa-miR-610	CLIP-seq
MIRT2513765	hsa-miR-628-3p	CLIP-seq
MIRT2513766	hsa-miR-636	CLIP-seq
MIRT1547877	hsa-miR-655	CLIP-seq
MIRT2513767	hsa-miR-767-3p	CLIP-seq
MIRT2513768	hsa-miR-873	CLIP-seq
MIRT2428182	hsa-miR-875-3p	CLIP-seq
MIRT2513769	hsa-miR-888	CLIP-seq
MIRT2428183	hsa-miR-921	CLIP-seq
MIRT2513770	hsa-miR-935	CLIP-seq
MIRT1547878	hsa-miR-96	CLIP-seq
MIRT2513771	hsa-miR-98	CLIP-seq
MIRT2513724	hsa-let-7a	CLIP-seq
MIRT2513725	hsa-let-7b	CLIP-seq
MIRT2513726	hsa-let-7c	CLIP-seq
MIRT2513727	hsa-let-7d	CLIP-seq
MIRT2513728	hsa-let-7e	CLIP-seq
MIRT2513729	hsa-let-7f	CLIP-seq
MIRT2513730	hsa-let-7g	CLIP-seq
MIRT2513731	hsa-let-7i	CLIP-seq
MIRT2513732	hsa-miR-103b	CLIP-seq
MIRT2428134	hsa-miR-105	CLIP-seq
MIRT2428135	hsa-miR-1202	CLIP-seq
MIRT2428136	hsa-miR-1207-5p	CLIP-seq
MIRT2513733	hsa-miR-1251	CLIP-seq
MIRT1547869	hsa-miR-1256	CLIP-seq
MIRT1547870	hsa-miR-1271	CLIP-seq
MIRT2513734	hsa-miR-1321	CLIP-seq
MIRT2428137	hsa-miR-1343	CLIP-seq
MIRT2428138	hsa-miR-145	CLIP-seq
MIRT2428139	hsa-miR-154	CLIP-seq
MIRT2428140	hsa-miR-181a	CLIP-seq
MIRT2428141	hsa-miR-181b	CLIP-seq
MIRT2428142	hsa-miR-181c	CLIP-seq
MIRT2428143	hsa-miR-181d	CLIP-seq
MIRT1547871	hsa-miR-182	CLIP-seq
MIRT2513735	hsa-miR-2113	CLIP-seq
MIRT2513736	hsa-miR-2117	CLIP-seq
MIRT2513737	hsa-miR-218	CLIP-seq
MIRT2428144	hsa-miR-224	CLIP-seq
MIRT2428145	hsa-miR-2467-5p	CLIP-seq
MIRT2428146	hsa-miR-299-3p	CLIP-seq
MIRT2428147	hsa-miR-3074-5p	CLIP-seq
MIRT2679080	hsa-miR-3119	CLIP-seq
MIRT2513738	hsa-miR-3143	CLIP-seq
MIRT2428148	hsa-miR-3145-5p	CLIP-seq
MIRT2513739	hsa-miR-3158-3p	CLIP-seq
MIRT2513740	hsa-miR-3160-5p	CLIP-seq
MIRT2513741	hsa-miR-3162-5p	CLIP-seq
MIRT2428149	hsa-miR-3163	CLIP-seq
MIRT2428150	hsa-miR-3180-5p	CLIP-seq
MIRT2428151	hsa-miR-3188	CLIP-seq
MIRT2513742	hsa-miR-325	CLIP-seq
MIRT2428152	hsa-miR-340	CLIP-seq
MIRT2428153	hsa-miR-3591-5p	CLIP-seq
MIRT2428154	hsa-miR-3606	CLIP-seq
MIRT2428155	hsa-miR-3607-5p	CLIP-seq
MIRT2513743	hsa-miR-3616-3p	CLIP-seq
MIRT926407	hsa-miR-3647-3p	CLIP-seq
MIRT2513744	hsa-miR-3662	CLIP-seq
MIRT2428156	hsa-miR-3671	CLIP-seq
MIRT2513745	hsa-miR-3675-3p	CLIP-seq
MIRT2428157	hsa-miR-3690	CLIP-seq
MIRT2428158	hsa-miR-371-5p	CLIP-seq
MIRT2428159	hsa-miR-371b-5p	CLIP-seq
MIRT1547872	hsa-miR-374c	CLIP-seq
MIRT2513746	hsa-miR-376c	CLIP-seq
MIRT2513747	hsa-miR-377	CLIP-seq
MIRT2679081	hsa-miR-3908	CLIP-seq
MIRT2513748	hsa-miR-3927	CLIP-seq
MIRT2679082	hsa-miR-3942-5p	CLIP-seq
MIRT2428160	hsa-miR-3972	CLIP-seq
MIRT2428161	hsa-miR-3975	CLIP-seq
MIRT2428162	hsa-miR-421	CLIP-seq
MIRT2428163	hsa-miR-4254	CLIP-seq
MIRT1547873	hsa-miR-4255	CLIP-seq
MIRT2428164	hsa-miR-4262	CLIP-seq
MIRT2513749	hsa-miR-4277	CLIP-seq
MIRT926409	hsa-miR-4282	CLIP-seq
MIRT2679083	hsa-miR-4293	CLIP-seq
MIRT2513750	hsa-miR-4305	CLIP-seq
MIRT1547874	hsa-miR-4450	CLIP-seq
MIRT2679084	hsa-miR-4452	CLIP-seq
MIRT2513752	hsa-miR-4458	CLIP-seq
MIRT1974474	hsa-miR-4464	CLIP-seq
MIRT2513753	hsa-miR-4500	CLIP-seq
MIRT1547875	hsa-miR-4642	CLIP-seq
MIRT2513754	hsa-miR-4650-3p	CLIP-seq
MIRT2513755	hsa-miR-4662a-3p	CLIP-seq
MIRT2513756	hsa-miR-4684-5p	CLIP-seq
MIRT2428165	hsa-miR-4699-3p	CLIP-seq
MIRT2679085	hsa-miR-4703-5p	CLIP-seq
MIRT2428166	hsa-miR-4709-5p	CLIP-seq
MIRT2428167	hsa-miR-4712-5p	CLIP-seq
MIRT2513757	hsa-miR-4721	CLIP-seq
MIRT2428168	hsa-miR-4736	CLIP-seq
MIRT2513758	hsa-miR-4739	CLIP-seq
MIRT2679086	hsa-miR-4742-3p	CLIP-seq
MIRT2428169	hsa-miR-4742-5p	CLIP-seq
MIRT1974475	hsa-miR-4748	CLIP-seq
MIRT2428170	hsa-miR-4755-3p	CLIP-seq
MIRT2513759	hsa-miR-4756-5p	CLIP-seq
MIRT2428171	hsa-miR-4763-3p	CLIP-seq
MIRT2679087	hsa-miR-4766-3p	CLIP-seq
MIRT926408	hsa-miR-4766-5p	CLIP-seq
MIRT2428172	hsa-miR-4776-3p	CLIP-seq
MIRT1547876	hsa-miR-4797-5p	CLIP-seq
MIRT2428173	hsa-miR-485-5p	CLIP-seq
MIRT2513760	hsa-miR-489	CLIP-seq
MIRT2679088	hsa-miR-491-3p	CLIP-seq
MIRT2513761	hsa-miR-494	CLIP-seq
MIRT2428174	hsa-miR-508-5p	CLIP-seq
MIRT2513762	hsa-miR-526b	CLIP-seq
MIRT926411	hsa-miR-548c-3p	CLIP-seq
MIRT2679089	hsa-miR-548g	CLIP-seq
MIRT2428176	hsa-miR-555	CLIP-seq
MIRT2428177	hsa-miR-556-5p	CLIP-seq
MIRT2513763	hsa-miR-578	CLIP-seq
MIRT2513764	hsa-miR-580	CLIP-seq
MIRT2679090	hsa-miR-586	CLIP-seq
MIRT2428178	hsa-miR-590-3p	CLIP-seq
MIRT2679091	hsa-miR-596	CLIP-seq
MIRT2428179	hsa-miR-607	CLIP-seq
MIRT2428180	hsa-miR-610	CLIP-seq
MIRT2513765	hsa-miR-628-3p	CLIP-seq
MIRT2513766	hsa-miR-636	CLIP-seq
MIRT1547877	hsa-miR-655	CLIP-seq
MIRT2513767	hsa-miR-767-3p	CLIP-seq
MIRT2428181	hsa-miR-770-5p	CLIP-seq
MIRT2513768	hsa-miR-873	CLIP-seq
MIRT2428182	hsa-miR-875-3p	CLIP-seq
MIRT2513769	hsa-miR-888	CLIP-seq
MIRT2428183	hsa-miR-921	CLIP-seq
MIRT2513770	hsa-miR-935	CLIP-seq
MIRT1547878	hsa-miR-96	CLIP-seq
MIRT2513771	hsa-miR-98	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
JUN	Repression	8798756
NR1H4	Activation	18514055

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	1747115, 11598131, 20026052, 25331875, 25789606
GO:0005539	Function	Glycosaminoglycan binding	IEA
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	TAS
GO:0009887	Process	Animal organ morphogenesis	TAS	7961765
GO:0010508	Process	Positive regulation of autophagy	IDA	23798385
GO:0010596	Process	Negative regulation of endothelial cell migration	IDA	23798385
GO:0016239	Process	Positive regulation of macroautophagy	IDA	23798385
GO:0016239	Process	Positive regulation of macroautophagy	IGI	23798385
GO:0016525	Process	Negative regulation of angiogenesis	IDA	23978385
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	ISS
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	RCA	20551380, 25037231, 27559042, 28327460, 28675934
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27559042, 28327460, 28675934
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	23798385
GO:0050840	Function	Extracellular matrix binding	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23798385
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IGI	23798385
GO:0090141	Process	Positive regulation of mitochondrial fission	IGI	23798385
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IDA	23798385

MIM	HGNC	e!Ensembl
125255	2705	ENSG00000011465

P07585

Protein name

Decorin (Bone proteoglycan II) (PG-S2) (PG40)

Protein function

May affect the rate of fibrils formation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01462	LRRNT	53 → 80	Leucine rich repeat N-terminal domain	Family
PF13855	LRR_8	81 → 141	Leucine rich repeat	Repeat
PF13855	LRR_8	150 → 218	Leucine rich repeat	Repeat
PF13855	LRR_8	221 → 281	Leucine rich repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Detected in placenta (at protein level) (PubMed:32337544). Detected in cerebrospinal fluid, fibroblasts and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:

Sequence

MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC
HLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKV
SPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIE
LGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAAS
LKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH
NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Sequence length

359

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Congenital stromal corneal dystrophy	Pathogenic	rs587777258, rs80338741, rs80338742, rs397515545	RCV000114315 RCV000018366 RCV000020465 RCV000055876	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL DYSTROPHY, CONGENITAL STROMAL	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DCN-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (303)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Achondrogenesis, type IB (disorder)	Achondrogenesis	BEFREE	11570921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	BEFREE	1670752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30604627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	31524274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	30320452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	10652025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	16414292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	12844226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	31725165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	12417272, 29158532, 9536978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19474808, 27315044, 28932086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	25079227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19320777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	30679601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19474808, 27315044, 28932086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	38256024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	16938379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	30551691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	28138904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24142880, 24146840, 30629950, 30779109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	24625664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33878734	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11054714, 15690056, 19036156, 19590249, 23007289, 23029096, 24403067, 25400079, 26467629, 28002796, 28174297, 28599447, 29984655, 30124739, 30551691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18293176, 19036156, 22363530, 23007289, 23350987, 24403067, 25400079, 32406376, 34055036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20398359, 28174297	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
CADASIL	Cadasil	Pubtator	25026535	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CADASIL	Cadasil	Pubtator	25578324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CADASIL Syndrome	CADASIL Syndrome	BEFREE	25578324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	10934647, 21791066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12927043, 18293176, 21360479, 22363530, 34358255, 35777025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21573075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11461082, 12521301, 29879025	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24083576, 32311840, 33878734, 34238253, 38420809, 39350070, 40349011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	21791066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24142880, 24146840, 30629950, 30779109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	18383852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21360479, 28793886, 30840274, 31659495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21637745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21637745	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34358255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21958730, 22507529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38188687	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	7706768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	9493904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30468093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32174066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carditis	Carditis	BEFREE	25079227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	8689458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	32180680	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	25578324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	25578324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27315044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	27315044		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30655899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30655899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24272200	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	30686515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	12115562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16938379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	16707515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11345837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	16005714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	15859521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1710888, 2162845, 22159220, 26001829, 28261350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12385781, 1710888	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	2162845, 8702560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	8522726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19678923, 26509701, 28530155, 28567416, 29956073, 31258726, 31524274, 31710116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	1710888, 28567416, 7624361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital corneal dystrophy	Congenital corneal dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 2A	Congenital disorder of glycosylation	Pubtator	7490271	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	7490271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	7490271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital stromal corneal dystrophy	Congenital Stromal Corneal Dystrophy	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congestive heart failure	Congestive Heart Failure	BEFREE	9493904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	29760442, 31196143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26547587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cornea plana	Cornea Plana	BEFREE	17558846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophies Hereditary	Corneal dystrophy	Pubtator	22870031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Congenital Stromal	Corneal dystrophy	Pubtator	22870031, 26828927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy, Congenital Stromal	Corneal Dystrophy, Congenital Stromal	ORPHANET_DG	15671264		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Dystrophy, Congenital Stromal	Corneal Dystrophy, Congenital Stromal	BEFREE	16935612, 20484579, 23685109, 24413633, 26029887		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Dystrophy, Congenital Stromal	Corneal Dystrophy, Congenital Stromal	GENOMICS_ENGLAND_DG	16935612		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Dystrophy, Congenital Stromal	Corneal Dystrophy, Congenital Stromal	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Dystrophy, Congenital Stromal	Corneal Dystrophy, Congenital Stromal	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Neovascularization	Corneal Neovascularization	BEFREE	22543480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Cutis Laxa	BEFREE	30574417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30551691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	18082196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
De Barsy syndrome	De barsy syndrome	Pubtator	26828927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27377816, 28846474, 31608236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	17660861	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	21723264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10344340, 10449443, 28290552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10344340, 10449443, 28290552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	10449443, 35119024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	10449443, 24204704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10449443, 10495473, 12187087, 14655518, 15041043, 30987676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18414424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28290552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	10652025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10344340, 11259366, 12187087, 20083846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	12187087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse mesangial sclerosis (disorder)	Mesangial sclerosis	BEFREE	10652025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysferlinopathy	Dysferlinopathy	BEFREE	16183658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	11532373, 15580559, 15859521, 16583246, 20533528, 20599673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	LHGDN	16583246		★★★★★ ★☆☆☆☆ Found in Text Mining only
EHLERS-DANLOS SYNDROME, SPONDYLODYSPLASTIC TYPE, 1	Ehlers-Danlos Syndrome	BEFREE	15859521, 16583246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10901378, 21207424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	16804899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10901378, 35832124	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	16804899		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	25244916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25244916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermal Nevus	Epidermal nevus	Pubtator	21958730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19212830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19212830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	16390543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	24913135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	30551691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	19320777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	11345837, 20956977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	31058531, 31331390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	25304290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	19145252	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31725165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16467781, 24625664, 31773303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26230845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16467781, 31773303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10092108, 10496172, 20702765, 29984655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16467781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	11168935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	22279542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	21494642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	24599399, 30528862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	30416782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	9493904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	18413650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12927043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29143549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27315044, 31446221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26956419, 28793886, 30416782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34209854	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	16390543		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	21494642, 31600491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	32041647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	31238825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	8012411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30987676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	18550571, 22159220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	18293176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	18413650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	31478096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	11683372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10495473, 12112390, 12187087, 20083846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11012890, 12112390, 32174066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	29762850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	23325086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	18383852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	26423601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	34321013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	25860607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	14633702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	19431195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	19431195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12521301, 23754492, 29879025, 30297672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11345837, 29879025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	29879025, 35159124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	2023219, 7625849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28793886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	34232735	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21360479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	21360479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21360479, 25524578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22363530	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35391926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	30009174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10092108, 10496172, 9930319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15690056, 19036156, 19590249, 23007289, 25400079, 26467629, 28002796, 28599447, 29984655, 30124739, 30551691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21207424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19212830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	18383852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23448253, 31271881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21360479, 28793886, 30840274, 31659495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	14633702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15269152, 28929492, 31150821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14613585, 19794963, 22880013, 25503693, 29368411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28323271, 28726786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24142880, 24146840, 30629950, 30779109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10382266, 12032837, 18383852, 21342131, 21360479, 22087031, 22159220, 23007289, 23351020, 24146840, 24424784, 25715761, 26001829, 26522384, 26547587 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	30867792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30655899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	1710888, 2162845, 22159220, 26001829, 28261350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11054714, 19036156, 26467629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	1479602, 1611907, 2211661, 8486665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	1479602, 2211661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	3949779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	27213335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Morphea	Morphea	BEFREE	2023219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	14633702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	21958730, 22507529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18436739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	18436739	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20456365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	20456365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	16183658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular dystrophy congenital, merosin negative	Congenital Muscular Dystrophy	BEFREE	16183658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	16989735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	16183658, 17662584, 22663383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	CTD_human_DG	12868502		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	31567996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	31251519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	29760442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	11425208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal Marfan syndrome	Marfan Syndrome	BEFREE	1479602, 8428751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10382266, 10913155, 12032837, 12060613, 12115562, 12631584, 15269152, 15690056, 18383852, 18413650, 18520035, 18550571, 18793406, 19590249, 19678923 View all (41 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	CTD_human_DG	16005714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	CTD_human_DG	16005714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Fibrosing Dermopathy	Nephrogenic Fibrosing Dermopathy	BEFREE	19864245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	BEFREE	10652025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26230845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28631095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30679601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24424784, 25524578, 30840274		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	30734678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18414424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27699222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
OSSIFICATION OF THE POSTERIOR LONGITUDINAL LIGAMENT OF SPINE	Ossification Of The Posterior Longitudinal Ligament Of Spine	BEFREE	8900925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11597178, 34208590, 35119024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthropathy Primary Hypertrophic	Primary hypertrophic osteoarthropathy	Pubtator	8592084	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	7484289, 8723103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	12975603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	35661288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18497961, 25860607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	18505923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	18505923, 20340016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12060613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35915456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15269152, 28929492, 31150821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	26471393, 28929492, 31150821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34021540	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	34964698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	16394277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	16394277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15785240, 31814850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	23007289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30763902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35112150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	19251763, 29630675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	29630675, 38488886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	15302515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	25400079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	31330507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28789706, 31099269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28789706	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	31725165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	30128605, 30347087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14613585, 19794963, 22880013, 25503693, 29368411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	14613585, 21804603, 31727599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19794963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32306717	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudoachondroplasia	Pseudoachondroplasia	BEFREE	1670752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	LHGDN	17396208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16707515, 19087346, 27418555, 33656381	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16780585, 22241744, 23997174, 32460521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	12573990, 26956419, 30416782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26547587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	12112390, 19697998, 9263690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	10652025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29485489, 29670537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	20597652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	30347087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	18413650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	20015203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	16902402, 19616852, 21743019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	22363530	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	19864245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondyloepimetaphyseal disorder	Spondyloepimetaphyseal dysplasia	BEFREE	9258750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12032837, 14633702, 16835231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32801084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24913135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28323271, 28726786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	28799258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32314688, 34379688, 37290894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19864245, 7625849, 9373715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	29620182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	33878734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	38256024	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	15785240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15785240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30124739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37963845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21840990, 24146840, 28459201, 35777025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28459201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35420507	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39372720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	25244916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	24602133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vulvar Lichen Sclerosus	Vulvar Lichen Sclerosus	LHGDN	17286067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	10495473		★★★★★ ★☆☆☆☆ Found in Text Mining only

DCN (decorin)