DCDC2C (doublecortin domain containing 2C)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 728597
Gene name Doublecortin domain containing 2C
Gene symbol DCDC2C
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2p25.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IDA 28395323
GO:0005737 Component Cytoplasm IEA
GO:0005815 Component Microtubule organizing center IBA
GO:0005874 Component Microtubule IBA
GO:0005929 Component Cilium IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MYV0
Protein name Doublecortin domain-containing protein 2C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03607 DCX 34 → 92 Doublecortin Family
PF03607 DCX 154 → 211 Doublecortin Family
Tissue specificity TISSUE SPECIFICITY: Expressed in testis and spermatozoa (at protein level). {ECO:0000269|PubMed:28395323}.
Sequence 
MGTRGPSAPVDTTPAKTIVVYRNGDPFYVGKKFVLSRRRAATFEALLEQLTEQVDVPFGV
RRLFTPTRGHRVLGLDALQAGGKYVAAGRERFKELDYIHIVPRKPAKIRKLKEIKPVVHC
DINVPSKWQTYHRISRHINVFTNGRLFIPPAKIIIPKFSLSDWDIVLATIGEKVFPLGGV
RKLFTMNGHLLGDSKDLQDNHFYVAVGLETFKYFPYWKSPRVPSEVQQRYANVEKNSQRK
KKVDSKGKEPCKYDGIPPKTQDSVYYAKEEKKKTLAEPLVQRGAEGDVYKAPTPSKETQG
ALDVKEEHNVQLEVPVDQRQAEIVKEDEEIHENTPDFEGNKDKEDARLCEDVERKMAREW
KPVD
Sequence length 364
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Cobalamin C disease Uncertain significance ClinVar
Disgenet 		—
★★★★★
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
TYPE 2 DIABETES MELLITUS — GWAS catalog 21490949
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Narcolepsy Narcolepsy GWASDB_DG 19629137
★★★★★
★☆☆☆☆
Found in Text Mining only
Pulmonary Disease Chronic Obstructive Chronic obstructive pulmonary disease Pubtator 29313708 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Rheumatoid Arthritis Rheumatoid arthritis GWASDB_DG 22491018
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for DCDC2C.

No additional diseases found yet through genes similar to DCDC2C.