DCDC2B (doublecortin domain containing 2B)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 149069
• Gene name: Doublecortin domain containing 2B
• Gene symbol: DCDC2B
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1p35.2
• Summary: This gene encodes a member of the doublecortin family. The protein encoded by this gene contains two doublecortin domains. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization. [provided by RefSeq, Sep 2010]

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT925966	hsa-miR-140-5p	CLIP-seq
MIRT925967	hsa-miR-3545-5p	CLIP-seq
MIRT925968	hsa-miR-4435	CLIP-seq
MIRT925969	hsa-miR-4460	CLIP-seq
MIRT2513563	hsa-miR-1287	CLIP-seq
MIRT2513564	hsa-miR-3135b	CLIP-seq
MIRT2513565	hsa-miR-3612	CLIP-seq
MIRT2513566	hsa-miR-3915	CLIP-seq
MIRT2513567	hsa-miR-3928	CLIP-seq
MIRT2513568	hsa-miR-3975	CLIP-seq
MIRT2513569	hsa-miR-4443	CLIP-seq
MIRT2513570	hsa-miR-4521	CLIP-seq
MIRT2513571	hsa-miR-650	CLIP-seq
MIRT2513563	hsa-miR-1287	CLIP-seq
MIRT2513564	hsa-miR-3135b	CLIP-seq
MIRT2513565	hsa-miR-3612	CLIP-seq
MIRT2513566	hsa-miR-3915	CLIP-seq
MIRT2513567	hsa-miR-3928	CLIP-seq
MIRT2513568	hsa-miR-3975	CLIP-seq
MIRT2513569	hsa-miR-4443	CLIP-seq
MIRT2513570	hsa-miR-4521	CLIP-seq
MIRT2513571	hsa-miR-650	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005874	Component	Microtubule	IBA
GO:0035556	Process	Intracellular signal transduction	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A2VCK2
• Protein name: Doublecortin domain-containing protein 2B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03607	DCX	27 → 85	Doublecortin	Family
  PF03607	DCX	147 → 205	Doublecortin	Family

• Sequence:

  MAGGSPAAKRVVVYRNGDPFFPGSQLVVTQRRFPTMEAFLCEVTSAVQAPLAVRALYTPC
  HGHPVTNLADLKNRGQYVAAGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIG
  RQLPAGAPSYIHVFRNGDLVSPPFSLKLSQAASQDWETVLKLLTEKVKLQSGAVCKLCTL
  EGLPLSAGKELVTGHYYVAVGEDEFKDLPYLELLVPSPSLPRGCWQPPGSKSRPHRQGAQ
  GHRAQVTQPSPKEPDRIKPSAFYARPQQTIQPRSKLPTLSFPSGVIGVYGAPHRRKETAG
  ALEVADDEDTQTEEPLDQRAAQIVEEALSLENQPGAGAAISASAPALPS

• Sequence length: 349

Related Genes

No strongly related genes found yet for DCDC2B.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DCDC2B.