DANCR (differentiation antagonizing non-protein coding RNA)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 57291
Gene name Differentiation antagonizing non-protein coding RNA
Gene symbol DANCR
Synonyms (NCBI Gene)
AGU2ANCRKIAA0114SNHG13lncRNA-ANCR
Chromosome 4
Chromosome location 4q12
Summary This gene produces a long non-coding RNA that functions as a negative regulator of cell differentiation. This transcript associates with enhancer of zeste homolog 2 to repress expression of the runt related transcription factor 2 gene. Increased expressio
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT732585 hsa-miR-145-5p qRT-PCR 33956301
MIRT733611 hsa-miR-335-5p Luciferase reporter assayqRT-PCRWestern blotting 33968662
MIRT734187 hsa-miR-33b-3p Luciferase reporter assayqRT-PCRWestern blotting 31515968
MIRT736933 hsa-miR-335-3p Luciferase reporter assayWestern blottingqRT-PCR 33968662
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
614625 28964 ENSG00000226950
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C864
Protein name Putative uncharacterized protein DANCR (Anti-differentiation ncRNA protein) (Differentiation antagonizing non-protein coding RNA) (Small nucleolar RNA host gene protein 13)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in keratinocytes. {ECO:0000269|PubMed:22302877}.
Sequence 
MAGPVPPHPGLAVRAAALHPAPLRIFPGLAELPDLSRGSAARPALAQSLPGIGCGPRDPP
ASLPAPRRLSGLCARRRSQASLSAGVARADAPLCSGFRAGHACGTGTQPQPTLSSRSSSL
TSAEVQLPQFLAQVDNYRHKPLKLECPVAGISIDLSQLSLQLQ
Sequence length 163
Interactions View interactions

No strongly related genes found yet for DANCR.

No additional diseases found yet through genes similar to DANCR.