Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	117154
Gene name	Dachshund family transcription factor 2
Gene symbol	DACH2
Synonyms (NCBI Gene)	-
Chromosome	X
Chromosome location	Xq21.2
Summary	This gene is one of two genes which encode a protein similar to the Drosophila protein dachshund, a transcription factor involved in cell fate determination in the eye, limb and genital disc of the fly. The encoded protein contains two characteristic dach

miRTarBase ID	miRNA	Experiments	Reference
MIRT2208920	hsa-miR-499-3p	CLIP-seq
MIRT2208921	hsa-miR-499a-3p	CLIP-seq

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0046545	Process	Development of primary female sexual characteristics	IEA

MIM	HGNC	e!Ensembl
300608	16814	ENSG00000126733

Q96NX9

Protein name

Dachshund homolog 2 (Dach2)

Protein function

Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator for SIX1 and SIX6. Seems to act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, includi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02437	Ski_Sno	59 → 161	SKI/SNO/DAC family	Family

Sequence

MAVSASPVISATSSGAGVPGGLFRAEPLYSTPREPPRLTPNMINSFVVNNHSNSAGGGGR
GNTNTNECRMVDMHGMKVASFLMDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDISP
VVCTVEQVRILRGLGAIQPGVNRCKLITRKDFETLFTDCTNARRKRQMTRKQAVNSSRPG
RPPKRSLGVLQENARLLTHAVPGLLSPGLITPTGITAAAMAEAMKLQKMKLMAMNTLQGN
GSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLN
PLQQNHLLTNRLDLPFMMMPHPLLPVSLPPASVAMAMNQMNHLNTIANMAAAAQIHSPLS
RAGTSVIKERIPESPSPAPSLEENHRPGSQTSSHTSSSVSSSPSQMDHHLERMEEVPVQI
PIMKSPLDKIQLTPGQALPAGFPGPFIFADSLSSVETLLTNIQGLLKVALDNARIQEKQI
QQEKKELRLELYREREIRENLERQLAVELQSRTTMQKRLKKEKKTKRKLQEALEFESKRR
EQVEQALKQATTSDSGLRMLKDTGIPDIEIENNGTPHDSAAMQGGNYYCLEMAQQLYSA

Sequence length

599

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormality of neuronal migration	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	30636644, 39633006	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (7)
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	25234129	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23727239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25744029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	15459172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	GENOMICS_ENGLAND_DG	10894934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	15459172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	25744029		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with DACH2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for DACH2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to DACH2 (see Related Genes above), that are NOT already directly curated for DACH2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to DACH2.

DACH2 (dachshund family transcription factor 2)

Bookmark This Gene