Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	375791
Gene name	Cysteine rich tail 1
Gene symbol	CYSRT1
Synonyms (NCBI Gene)	C9orf169
Chromosome	9
Chromosome location	9q34.3

7 Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IDA	36804407
GO:0001533	Component	Cornified envelope	IEA
GO:0005515	Function	Protein binding	IPI	27107012, 32296183, 36804407
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0051702	Process	Biological process involved in interaction with symbiont	IDA	36804407
GO:0061436	Process	Establishment of skin barrier	IDA	36804407
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein name

Cysteine-rich tail protein 1

Protein function

Component of the stratum corneum that may contribute to epidermal antimicrobial host defenses.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10631	DUF2477	1 → 141	Protein of unknown function (DUF2477)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the stratum granulosum, in skin and oral epithelia (at protein level). {ECO:0000269|PubMed:36804407}.

Sequence

MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQP
TEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCC
CPCCHCCHCPPFCRCHSCCCCVIS

Sequence length

144

Interactions

View interactions

Related Genes Genes most often co-reported with CYSRT1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CYSRT1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CYSRT1 (see Related Genes above), that are NOT already directly curated for CYSRT1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CYSRT1.

CYSRT1 (cysteine rich tail 1)