CYP4Z2P (cytochrome P450 family 4 subfamily Z member 2, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 163720
Gene name Cytochrome P450 family 4 subfamily Z member 2, pseudogene
Gene symbol CYP4Z2P
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1p33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004497 Function Monooxygenase activity IEA
GO:0005506 Function Iron ion binding IEA
GO:0016020 Component Membrane IEA
GO:0016705 Function Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen IEA
GO:0020037 Function Heme binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618954 24426 ENSG00000290456
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N1L4
Protein name Putative inactive cytochrome P450 family member 4Z2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00067 p450 47 → 340 Cytochrome P450 Domain
Tissue specificity TISSUE SPECIFICITY: Detected at low levels in mammary gland and mammary carcinoma. {ECO:0000269|PubMed:15059886}.
Sequence 
MEPSWLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRWTIRAMHLFPAPPAHWFYGHKES
YPVKEFEVYPELMEKYPCAVPLWVGPFTMFFNIHDPDYVKILLKRQDPKSAVSHKILESW
VGRGLVTLDGSKWKKHRQIVKPGFNISILKIFITMMSKSVRMMLNKWEEHIAQNSRLELF
QHVSLMTLDSIMKCAFSHQGSIQLDSTLDSYLKAVFNLSKISNQRMNNFLHHNDLVFKFS
SQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKRRQDFLDILLSAKSENTKDFS
EADLQAEVKTFMFAGHDTTTTAISWIFYCLAKYPEHQQRC
Sequence length 340
Interactions View interactions

No strongly related genes found yet for CYP4Z2P.

No additional diseases found yet through genes similar to CYP4Z2P.