CYP2G1P (cytochrome P450 family 2 subfamily G member 1, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 22952
Gene name Cytochrome P450 family 2 subfamily G member 1, pseudogene
Gene symbol CYP2G1P
Synonyms (NCBI Gene)
CYP2G1CYP2G2PCYP2GP1
Chromosome 19
Chromosome location 19q13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004497 Function Monooxygenase activity IEA
GO:0005506 Function Iron ion binding IEA
GO:0016705 Function Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen IEA
GO:0020037 Function Heme binding IEA
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
601133 2633 ENSG00000290611
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZSU1
Protein name Putative inactive cytochrome P450 2G1 (Cytochrome P450 2G1 pseudogene)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00067 p450 1 → 143 Cytochrome P450 Domain
Sequence 
MPYTDVVIHEIQRLVDIVPMGVPHNIIQDTQFRGYLLPKGTDVFPLLGSVLKDPKYFRYP
DAFYPQHFLDEQGRFKKNEAFVPFSSGKRICLGEAMARMELFLYFTSTLQNFSLCSLVPL
VDIDITPKLSGFGNITPTYELCLVAR
Sequence length 146
Interactions View interactions

No strongly related genes found yet for CYP2G1P.

No additional diseases found yet through genes similar to CYP2G1P.