CXCL3 (C-X-C motif chemokine ligand 3)

Gene

• Entrez ID: 2921
• Gene name: C-X-C motif chemokine ligand 3
• Gene symbol: CXCL3
• Synonyms (NCBI Gene): CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattra

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005823	hsa-miR-204-5p	Microarray	21282569
MIRT018278	hsa-miR-335-5p	Microarray	18185580
MIRT023824	hsa-miR-1-3p	Microarray	18668037
MIRT711194	hsa-miR-100-3p	HITS-CLIP	19536157
MIRT711193	hsa-miR-3161	HITS-CLIP	19536157
MIRT711194	hsa-miR-100-3p	HITS-CLIP	19536157
MIRT711193	hsa-miR-3161	HITS-CLIP	19536157
MIRT711194	hsa-miR-100-3p	HITS-CLIP	19536157
MIRT711193	hsa-miR-3161	HITS-CLIP	19536157
MIRT711194	hsa-miR-100-3p	HITS-CLIP	19536157
MIRT711193	hsa-miR-3161	HITS-CLIP	19536157
MIRT711194	hsa-miR-100-3p	HITS-CLIP	19536157
MIRT711193	hsa-miR-3161	HITS-CLIP	19536157
MIRT711194	hsa-miR-100-3p	HITS-CLIP	19536157
MIRT711193	hsa-miR-3161	HITS-CLIP	19536157
MIRT711194	hsa-miR-100-3p	HITS-CLIP	19536157
MIRT711193	hsa-miR-3161	HITS-CLIP	19536157
MIRT711194	hsa-miR-100-3p	HITS-CLIP	19536157
MIRT711193	hsa-miR-3161	HITS-CLIP	19536157
MIRT2511332	hsa-miR-1245	CLIP-seq
MIRT2511333	hsa-miR-1273d	CLIP-seq
MIRT2511334	hsa-miR-1279	CLIP-seq
MIRT2511335	hsa-miR-132	CLIP-seq
MIRT2511336	hsa-miR-145	CLIP-seq
MIRT2511337	hsa-miR-150	CLIP-seq
MIRT2511338	hsa-miR-181a	CLIP-seq
MIRT2511339	hsa-miR-181b	CLIP-seq
MIRT2511340	hsa-miR-181c	CLIP-seq
MIRT2511341	hsa-miR-181d	CLIP-seq
MIRT2511342	hsa-miR-204	CLIP-seq
MIRT2511343	hsa-miR-211	CLIP-seq
MIRT2511344	hsa-miR-212	CLIP-seq
MIRT2511345	hsa-miR-2355-5p	CLIP-seq
MIRT2511346	hsa-miR-300	CLIP-seq
MIRT2511347	hsa-miR-3121-3p	CLIP-seq
MIRT2511348	hsa-miR-3156-3p	CLIP-seq
MIRT2511349	hsa-miR-3163	CLIP-seq
MIRT2511350	hsa-miR-3169	CLIP-seq
MIRT2511351	hsa-miR-3177-5p	CLIP-seq
MIRT2511352	hsa-miR-3613-3p	CLIP-seq
MIRT2511353	hsa-miR-381	CLIP-seq
MIRT2511354	hsa-miR-3925-3p	CLIP-seq
MIRT2511355	hsa-miR-3938	CLIP-seq
MIRT2511356	hsa-miR-425	CLIP-seq
MIRT2511357	hsa-miR-4262	CLIP-seq
MIRT2511358	hsa-miR-4286	CLIP-seq
MIRT2511359	hsa-miR-4301	CLIP-seq
MIRT2511360	hsa-miR-4307	CLIP-seq
MIRT2511361	hsa-miR-4436a	CLIP-seq
MIRT2511362	hsa-miR-4495	CLIP-seq
MIRT2511363	hsa-miR-4655-3p	CLIP-seq
MIRT2511364	hsa-miR-4713-5p	CLIP-seq
MIRT2511365	hsa-miR-4740-5p	CLIP-seq
MIRT2511366	hsa-miR-4755-5p	CLIP-seq
MIRT2511367	hsa-miR-494	CLIP-seq
MIRT2511368	hsa-miR-532-3p	CLIP-seq
MIRT2511369	hsa-miR-548aa	CLIP-seq
MIRT2511370	hsa-miR-548l	CLIP-seq
MIRT2511371	hsa-miR-548n	CLIP-seq
MIRT2511372	hsa-miR-562	CLIP-seq
MIRT2511373	hsa-miR-576-3p	CLIP-seq
MIRT2511374	hsa-miR-584	CLIP-seq
MIRT2511375	hsa-miR-603	CLIP-seq
MIRT2511376	hsa-miR-607	CLIP-seq
MIRT2511377	hsa-miR-610	CLIP-seq
MIRT2511378	hsa-miR-623	CLIP-seq
MIRT2511379	hsa-miR-640	CLIP-seq
MIRT2511380	hsa-miR-642b	CLIP-seq
MIRT2511332	hsa-miR-1245	CLIP-seq
MIRT2511333	hsa-miR-1273d	CLIP-seq
MIRT2678860	hsa-miR-1273e	CLIP-seq
MIRT2511334	hsa-miR-1279	CLIP-seq
MIRT2511335	hsa-miR-132	CLIP-seq
MIRT2511337	hsa-miR-150	CLIP-seq
MIRT2511338	hsa-miR-181a	CLIP-seq
MIRT2511339	hsa-miR-181b	CLIP-seq
MIRT2511340	hsa-miR-181c	CLIP-seq
MIRT2511341	hsa-miR-181d	CLIP-seq
MIRT2511342	hsa-miR-204	CLIP-seq
MIRT2511343	hsa-miR-211	CLIP-seq
MIRT2511344	hsa-miR-212	CLIP-seq
MIRT2511346	hsa-miR-300	CLIP-seq
MIRT2678861	hsa-miR-302f	CLIP-seq
MIRT2511347	hsa-miR-3121-3p	CLIP-seq
MIRT2511348	hsa-miR-3156-3p	CLIP-seq
MIRT2511349	hsa-miR-3163	CLIP-seq
MIRT2511350	hsa-miR-3169	CLIP-seq
MIRT2511351	hsa-miR-3177-5p	CLIP-seq
MIRT2678862	hsa-miR-33a	CLIP-seq
MIRT2678863	hsa-miR-33b	CLIP-seq
MIRT2511353	hsa-miR-381	CLIP-seq
MIRT2511355	hsa-miR-3938	CLIP-seq
MIRT2511356	hsa-miR-425	CLIP-seq
MIRT2511357	hsa-miR-4262	CLIP-seq
MIRT2511359	hsa-miR-4301	CLIP-seq
MIRT2511360	hsa-miR-4307	CLIP-seq
MIRT2678864	hsa-miR-4327	CLIP-seq
MIRT2511361	hsa-miR-4436a	CLIP-seq
MIRT2511362	hsa-miR-4495	CLIP-seq
MIRT2511364	hsa-miR-4713-5p	CLIP-seq
MIRT2511365	hsa-miR-4740-5p	CLIP-seq
MIRT2511366	hsa-miR-4755-5p	CLIP-seq
MIRT2511367	hsa-miR-494	CLIP-seq
MIRT2511368	hsa-miR-532-3p	CLIP-seq
MIRT2511369	hsa-miR-548aa	CLIP-seq
MIRT2511370	hsa-miR-548l	CLIP-seq
MIRT2511371	hsa-miR-548n	CLIP-seq
MIRT2511373	hsa-miR-576-3p	CLIP-seq
MIRT2511374	hsa-miR-584	CLIP-seq
MIRT2511375	hsa-miR-603	CLIP-seq
MIRT2511377	hsa-miR-610	CLIP-seq
MIRT2511378	hsa-miR-623	CLIP-seq
MIRT2511379	hsa-miR-640	CLIP-seq
MIRT2511380	hsa-miR-642b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	10095777
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	ISS
GO:0030593	Process	Neutrophil chemotaxis	ISS
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249

Other IDs

• MIM: 139111
• HGNC: 4604
• e!Ensembl: ENSG00000163734

Protein

• UniProt ID: P19876
• Protein name: C-X-C motif chemokine 3 (GRO-gamma(1-73)) (Growth-regulated protein gamma) (GRO-gamma) (Macrophage inflammatory protein 2-beta) (MIP2-beta) [Cleaved into: GRO-gamma(5-73)]
• Protein function: Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher
• PDB: 8XWF, 8XX3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	41 → 100	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
  NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

• Sequence length: 107

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE, DIASTOLIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31709538		★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18205922, 28708839	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	18774390, 23904157	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24605943		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18045955, 32986377, 33176622	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	25485576	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36938723, 38169579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32376891	Stimulate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18205922	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31030900		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31667838		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20636398, 24935374	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31709538		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31105713		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32566650	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20162422, 31545503		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32600423, 33140821, 36246978, 38031087	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	38297356	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30905761, 30991021		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29209625, 32337262	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30973890, 30991021, 31545503, 31781593, 32058945, 32351322, 32462020, 32566650, 34083590, 35664357, 38031087	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	39464889	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37904449, 38206700	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35116032	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	CTD_human_DG	29556499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C	Hepatitis c	Pubtator	26314558	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	27638007		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27638007		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	19448742		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	19448742		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35042389	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	38297356	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37540227	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	37266432	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29209625	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24605943		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26837773, 29524043		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24605943, 26837773, 29524043, 29884302, 31667838		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31545503		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24605943		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18975380, 20162422, 29276973, 29524043, 30905761, 31545503		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31616413		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23300534, 37644468	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36012531	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29904933		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	38206700	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	24279306	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26837773, 29524043		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	22363459	Associate	★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	24903614	Stimulate	★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	25501066	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28708839		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29296528		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34870709	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37161430	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28912935		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	24903614	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	31545503, 36226612	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35515000	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35377948	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29854840, 34517533	Associate	★☆☆☆☆ Found in Text Mining only
Xanthoma tendinosum	Xanthoma Tendinosum	BEFREE	19448742		★☆☆☆☆ Found in Text Mining only