Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	2920
Gene name	C-X-C motif chemokine ligand 2
Gene symbol	CXCL2
Synonyms (NCBI Gene)	CINC-2aGRO2GRObMGSA-bMIP-2aMIP2MIP2ASCYB2
Chromosome	4
Chromosome location	4q13.3
Summary	This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residue

167

Show/Hide all (167)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018317	hsa-miR-335-5p	Microarray	18185580
MIRT023893	hsa-miR-1-3p	Microarray	18668037
MIRT027726	hsa-miR-98-5p	Microarray	19088304
MIRT438285	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT438285	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT733913	hsa-miR-532-5p	Luciferase reporter assay	26807173
MIRT733913	hsa-miR-532-5p	Luciferase reporter assayqRT-PCR	34093945
MIRT733913	hsa-miR-532-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	32308429
MIRT756209	hsa-miR-4512	Luciferase reporter assayWestern blottingqRT-PCR	34721432
MIRT756291	hsa-miR-27a-3p	Luciferase reporter assayWestern blottingqRT-PCR	37854860
MIRT918048	hsa-miR-4279	CLIP-seq
MIRT1972118	hsa-miR-1184	CLIP-seq
MIRT1972119	hsa-miR-1205	CLIP-seq
MIRT1972120	hsa-miR-1301	CLIP-seq
MIRT1972121	hsa-miR-3158-5p	CLIP-seq
MIRT1972122	hsa-miR-4660	CLIP-seq
MIRT1972123	hsa-miR-4757-5p	CLIP-seq
MIRT1972124	hsa-miR-5047	CLIP-seq
MIRT2511255	hsa-miR-128	CLIP-seq
MIRT2511256	hsa-miR-141	CLIP-seq
MIRT2511257	hsa-miR-181a	CLIP-seq
MIRT2511258	hsa-miR-181b	CLIP-seq
MIRT2511259	hsa-miR-181c	CLIP-seq
MIRT2511260	hsa-miR-181d	CLIP-seq
MIRT2511261	hsa-miR-190	CLIP-seq
MIRT2511262	hsa-miR-190b	CLIP-seq
MIRT2511263	hsa-miR-192	CLIP-seq
MIRT2511264	hsa-miR-193a-3p	CLIP-seq
MIRT2511265	hsa-miR-193b	CLIP-seq
MIRT2511266	hsa-miR-200a	CLIP-seq
MIRT2511267	hsa-miR-2116	CLIP-seq
MIRT2511268	hsa-miR-215	CLIP-seq
MIRT2511269	hsa-miR-217	CLIP-seq
MIRT2511270	hsa-miR-2276	CLIP-seq
MIRT2511271	hsa-miR-23a	CLIP-seq
MIRT2511272	hsa-miR-23b	CLIP-seq
MIRT2511273	hsa-miR-23c	CLIP-seq
MIRT2511274	hsa-miR-2682	CLIP-seq
MIRT2511275	hsa-miR-27a	CLIP-seq
MIRT2511276	hsa-miR-27b	CLIP-seq
MIRT2511277	hsa-miR-3121-3p	CLIP-seq
MIRT2511278	hsa-miR-3123	CLIP-seq
MIRT2511279	hsa-miR-3143	CLIP-seq
MIRT2511280	hsa-miR-3145-3p	CLIP-seq
MIRT2511281	hsa-miR-3163	CLIP-seq
MIRT2511282	hsa-miR-3168	CLIP-seq
MIRT2511283	hsa-miR-3187-3p	CLIP-seq
MIRT2511284	hsa-miR-320a	CLIP-seq
MIRT2511285	hsa-miR-320b	CLIP-seq
MIRT2511286	hsa-miR-320c	CLIP-seq
MIRT2511287	hsa-miR-320d	CLIP-seq
MIRT2511288	hsa-miR-3545-3p	CLIP-seq
MIRT2511289	hsa-miR-3607-5p	CLIP-seq
MIRT2511290	hsa-miR-3617	CLIP-seq
MIRT2511291	hsa-miR-3662	CLIP-seq
MIRT2511292	hsa-miR-3671	CLIP-seq
MIRT2511293	hsa-miR-3689a-5p	CLIP-seq
MIRT2511294	hsa-miR-3689b	CLIP-seq
MIRT2511295	hsa-miR-3689e	CLIP-seq
MIRT2511296	hsa-miR-3689f	CLIP-seq
MIRT2511297	hsa-miR-3714	CLIP-seq
MIRT2511298	hsa-miR-3925-5p	CLIP-seq
MIRT2511299	hsa-miR-3940-5p	CLIP-seq
MIRT2511300	hsa-miR-409-3p	CLIP-seq
MIRT2511301	hsa-miR-421	CLIP-seq
MIRT2511302	hsa-miR-4261	CLIP-seq
MIRT2511303	hsa-miR-4262	CLIP-seq
MIRT2511304	hsa-miR-432	CLIP-seq
MIRT2511305	hsa-miR-4320	CLIP-seq
MIRT2511306	hsa-miR-4429	CLIP-seq
MIRT2511307	hsa-miR-4446-5p	CLIP-seq
MIRT2511308	hsa-miR-449c	CLIP-seq
MIRT2511309	hsa-miR-4507	CLIP-seq
MIRT2511310	hsa-miR-4517	CLIP-seq
MIRT2511311	hsa-miR-4529-5p	CLIP-seq
MIRT2511312	hsa-miR-4633-5p	CLIP-seq
MIRT2511313	hsa-miR-4637	CLIP-seq
MIRT2511314	hsa-miR-4686	CLIP-seq
MIRT2511315	hsa-miR-4695-3p	CLIP-seq
MIRT2511316	hsa-miR-4755-5p	CLIP-seq
MIRT2511317	hsa-miR-4772-3p	CLIP-seq
MIRT2511318	hsa-miR-4773	CLIP-seq
MIRT2511319	hsa-miR-4789-3p	CLIP-seq
MIRT2511320	hsa-miR-495	CLIP-seq
MIRT2511321	hsa-miR-520d-5p	CLIP-seq
MIRT2511322	hsa-miR-524-5p	CLIP-seq
MIRT2511323	hsa-miR-539	CLIP-seq
MIRT2511324	hsa-miR-543	CLIP-seq
MIRT2511325	hsa-miR-578	CLIP-seq
MIRT2511326	hsa-miR-582-5p	CLIP-seq
MIRT2511327	hsa-miR-607	CLIP-seq
MIRT2511328	hsa-miR-629	CLIP-seq
MIRT2511329	hsa-miR-641	CLIP-seq
MIRT2511330	hsa-miR-670	CLIP-seq
MIRT2511331	hsa-miR-935	CLIP-seq
MIRT2511256	hsa-miR-141	CLIP-seq
MIRT2511257	hsa-miR-181a	CLIP-seq
MIRT2511258	hsa-miR-181b	CLIP-seq
MIRT2511259	hsa-miR-181c	CLIP-seq
MIRT2511260	hsa-miR-181d	CLIP-seq
MIRT2511261	hsa-miR-190	CLIP-seq
MIRT2511262	hsa-miR-190b	CLIP-seq
MIRT2511263	hsa-miR-192	CLIP-seq
MIRT2511264	hsa-miR-193a-3p	CLIP-seq
MIRT2511265	hsa-miR-193b	CLIP-seq
MIRT2511266	hsa-miR-200a	CLIP-seq
MIRT2511267	hsa-miR-2116	CLIP-seq
MIRT2511268	hsa-miR-215	CLIP-seq
MIRT2511269	hsa-miR-217	CLIP-seq
MIRT2511270	hsa-miR-2276	CLIP-seq
MIRT2511271	hsa-miR-23a	CLIP-seq
MIRT2511272	hsa-miR-23b	CLIP-seq
MIRT2511273	hsa-miR-23c	CLIP-seq
MIRT2511274	hsa-miR-2682	CLIP-seq
MIRT2511277	hsa-miR-3121-3p	CLIP-seq
MIRT2511278	hsa-miR-3123	CLIP-seq
MIRT2511279	hsa-miR-3143	CLIP-seq
MIRT2511280	hsa-miR-3145-3p	CLIP-seq
MIRT2511281	hsa-miR-3163	CLIP-seq
MIRT2511282	hsa-miR-3168	CLIP-seq
MIRT2511283	hsa-miR-3187-3p	CLIP-seq
MIRT2511284	hsa-miR-320a	CLIP-seq
MIRT2511285	hsa-miR-320b	CLIP-seq
MIRT2511286	hsa-miR-320c	CLIP-seq
MIRT2511287	hsa-miR-320d	CLIP-seq
MIRT2511288	hsa-miR-3545-3p	CLIP-seq
MIRT2511289	hsa-miR-3607-5p	CLIP-seq
MIRT2511290	hsa-miR-3617	CLIP-seq
MIRT2511291	hsa-miR-3662	CLIP-seq
MIRT2511292	hsa-miR-3671	CLIP-seq
MIRT2511293	hsa-miR-3689a-5p	CLIP-seq
MIRT2511294	hsa-miR-3689b	CLIP-seq
MIRT2511295	hsa-miR-3689e	CLIP-seq
MIRT2511296	hsa-miR-3689f	CLIP-seq
MIRT2511297	hsa-miR-3714	CLIP-seq
MIRT2511298	hsa-miR-3925-5p	CLIP-seq
MIRT2511299	hsa-miR-3940-5p	CLIP-seq
MIRT2511301	hsa-miR-421	CLIP-seq
MIRT2511302	hsa-miR-4261	CLIP-seq
MIRT2511303	hsa-miR-4262	CLIP-seq
MIRT2511304	hsa-miR-432	CLIP-seq
MIRT2511305	hsa-miR-4320	CLIP-seq
MIRT2511306	hsa-miR-4429	CLIP-seq
MIRT2511307	hsa-miR-4446-5p	CLIP-seq
MIRT2511308	hsa-miR-449c	CLIP-seq
MIRT2511309	hsa-miR-4507	CLIP-seq
MIRT2511310	hsa-miR-4517	CLIP-seq
MIRT2511311	hsa-miR-4529-5p	CLIP-seq
MIRT2511312	hsa-miR-4633-5p	CLIP-seq
MIRT2511313	hsa-miR-4637	CLIP-seq
MIRT2511314	hsa-miR-4686	CLIP-seq
MIRT2511315	hsa-miR-4695-3p	CLIP-seq
MIRT2511316	hsa-miR-4755-5p	CLIP-seq
MIRT2511317	hsa-miR-4772-3p	CLIP-seq
MIRT2511318	hsa-miR-4773	CLIP-seq
MIRT2511319	hsa-miR-4789-3p	CLIP-seq
MIRT2511320	hsa-miR-495	CLIP-seq
MIRT2511321	hsa-miR-520d-5p	CLIP-seq
MIRT2511322	hsa-miR-524-5p	CLIP-seq
MIRT2511324	hsa-miR-543	CLIP-seq
MIRT2511325	hsa-miR-578	CLIP-seq
MIRT2511326	hsa-miR-582-5p	CLIP-seq
MIRT2511327	hsa-miR-607	CLIP-seq
MIRT2511328	hsa-miR-629	CLIP-seq
MIRT2511329	hsa-miR-641	CLIP-seq
MIRT2511330	hsa-miR-670	CLIP-seq
MIRT2511331	hsa-miR-935	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
NFKB1	Unknown	17363596
RELA	Unknown	17363596
SMAD1	Unknown	17363596

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002237	Process	Response to molecule of bacterial origin	IDA	19912257
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	18275857, 21314817, 28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	9873037
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	2643119
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	2643119
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	9873037
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0060326	Process	Cell chemotaxis	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249

MIM	HGNC	e!Ensembl
139110	4603	ENSG00000081041

P19875

Protein name

C-X-C motif chemokine 2 (Growth-regulated protein beta) (Gro-beta) (Macrophage inflammatory protein 2-alpha) (MIP2-alpha) [Cleaved into: GRO-beta(5-73) (GRO-beta-T) (Hematopoietic synergistic factor) (HSF) (SB-251353)]

Protein function

Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic act

PDB

1QNK , 5OB5 , 8XVU , 8XXH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	41 → 100	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Sequence

MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Sequence length

107

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE RESORPTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (177)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	30738992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35500219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	26345899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	26345899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	16324872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27776263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28437540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27826542, 31752549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19606256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Experimental	Experimental arthritis	Pubtator	15146413	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	39699225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18205922, 28767591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	18774390, 23904157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24641287	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28684908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27826542, 31752549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	36226612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27721403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33807899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18045955, 25999348, 29495008, 32988253	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	25801245, 26063953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25801245, 32267022, 34085699, 34429454, 36411463, 36938723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27117207	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27721403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33530204, 34474677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34789165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32481352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37540227	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33588862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26063953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31752549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	31396817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18205922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	20420814	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31183363, 35856366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24935374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	21224055		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	23099361		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26747783		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	30232275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30298062, 30782668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36246978, 38031087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26208990, 28811711, 31781593, 34419055, 39940699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32337262, 34233297	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	22352330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30032137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	35647843, 39199011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	30703475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	23043087, 31311988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15292528, 23965695, 24635637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	15292528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31034777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	23178550		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	24337738, 30459600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37656997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	30339978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	37717172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24337738, 30459600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22615136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	38232115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	34269788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21211656	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21509778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21509778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	21509778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21677836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31585800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28757911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	34471638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	25944970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25944970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33571109, 33807899, 35856448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	35647843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen Storage Disease	LHGDN	18191274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	25114117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	25114117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	22352330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	22352330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	27655254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31106596	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	32267022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	26314558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	33785040	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	39252231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	22352330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune system disease	Pubtator	39252231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	12374626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	38199515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	24795505, 35042389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23198952, 31752549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37540227	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28927085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	22352330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27545880, 31617252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27545880, 31617252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	31752148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30293547, 30564899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27655254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	39619227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	7882902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30871526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21677836	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25801245, 34789197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22615136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21509778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	21509778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26063953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27721403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27630154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30232275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17999991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	30351498		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11719444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15899804, 35940046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30870978	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	34859836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31034777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	12374626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28966687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34761615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25697397, 30201769, 31556809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	22352330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30408466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	31772617, 39809140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	23787997, 23817216, 24788885, 25944970, 27375023, 27425378, 27737879, 29483644, 29703902, 30259595, 30293547, 30295647, 30298062, 30307035, 30564899, 31208461, 7669585, 7780962 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	31752148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	25762737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23372021, 24782490, 27797749, 31752549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35894174, 37063877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37166450	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	15292528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	24795505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	24795505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	24795505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31292171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32643867, 38341855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26063953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23300534, 24376747, 26063953, 33530204, 38527595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	30134811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36012531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35154475, 37063877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	22344199	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	24279306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32339056, 36524848, 37698493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	30134811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29920221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	38115636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	16324872		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyelonephritis	Pyelonephritis	BEFREE	28765918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	24903614	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	25501066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	15292528		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27797749, 28767591		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	33276795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	34982796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	37372943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16421598, 17944017, 29432911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	39252231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29296528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36281171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	24903614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	36226612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	30339978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19203362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29854840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34517533	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34789197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	29266409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	33509158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CXCL2 (C-X-C motif chemokine ligand 2)