CXCL17 (C-X-C motif chemokine ligand 17)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 284340
• Gene name: C-X-C motif chemokine ligand 17
• Gene symbol: CXCL17
• Synonyms (NCBI Gene): DMC, Dcip1, UNQ473, VCC-1, VCC1
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: The protein encoded by this gene is a mucosal chemokine that attracts immature dendritic cells and blood monocytes to the lungs. The encoded protein also promotes tumorigenesis through an angiogenic activity. Finally, this protein exhibits strong antimicr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT755533	hsa-miR-149-5p	qRT-PCR	36250208
MIRT2207927	hsa-miR-1253	CLIP-seq
MIRT2207928	hsa-miR-3117-5p	CLIP-seq
MIRT2207929	hsa-miR-3185	CLIP-seq
MIRT2207930	hsa-miR-4704-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0005515	Function	Protein binding	IPI	28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IMP	23115081
GO:0006935	Process	Chemotaxis	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IBA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	23115081
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IBA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IMP	23115081
GO:0030154	Process	Cell differentiation	IEA
GO:0048246	Process	Macrophage chemotaxis	IBA
GO:0048246	Process	Macrophage chemotaxis	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IBA
GO:0050728	Process	Negative regulation of inflammatory response	IMP	23115081
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	23115081
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IBA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IMP	23115081

Other IDs

• MIM: 611387
• HGNC: 19232
• e!Ensembl: ENSG00000189377

Protein

• UniProt ID: Q6UXB2
• Protein name: C-X-C motif chemokine 17 (6-Cys CXCL17) (Dendritic cell and monocyte chemokine-like protein) (DMC) (VEGF coregulated chemokine 1) [Cleaved into: 4-Cys CXCL17]
• Protein function: Chemokine that acts as a chemoattractant for monocytes, macrophages and dendritic cells (PubMed:16455961, PubMed:23115081). Plays a role in angiogenesis and possibly in the development of tumors (PubMed:16989774, PubMed:23115081). Acts as an ant
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15211	CXCL17	23 → 111	VEGF co-regulated chemokine 1	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in trachea, stomach, lung and skeletal muscle. Detected in intestine and in normal and asthmatic lung (at protein level). Breast tumors showed 3- to 24-fold up-regulation. {ECO:0000269|PubMed:16455961, ECO:0000269|PubMed:16989
• Sequence:

  MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAP
  RRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL

• Sequence length: 119

Pathways

KEGG Pathway:

Cytokine-cytokine receptor interaction

Related Genes

No strongly related genes found yet for CXCL17.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CXCL17.