Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1520
Gene name	Cathepsin S
Gene symbol	CTSS
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1q21.3
Summary	The preproprotein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that participates in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. The mature protein cleaves t

332 Show/Hide all (332)

miRTarBase ID	miRNA	Experiments	Reference
MIRT704399	hsa-miR-8066	HITS-CLIP	23313552
MIRT704398	hsa-miR-3622a-3p	HITS-CLIP	23313552
MIRT704397	hsa-miR-3622b-3p	HITS-CLIP	23313552
MIRT704396	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT704395	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT704394	hsa-miR-4459	HITS-CLIP	23313552
MIRT704393	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT704392	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT704391	hsa-miR-544b	HITS-CLIP	23313552
MIRT704390	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT704389	hsa-miR-4794	HITS-CLIP	23313552
MIRT704388	hsa-miR-664a-5p	HITS-CLIP	23313552
MIRT704387	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT704386	hsa-miR-769-5p	HITS-CLIP	23313552
MIRT704385	hsa-miR-3672	HITS-CLIP	23313552
MIRT704384	hsa-miR-6864-3p	HITS-CLIP	23313552
MIRT440859	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440857	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440859	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT727921	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT727920	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT727919	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT727918	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT440857	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT733948	hsa-miR-4498	Luciferase reporter assayqRT-PCR	33013913
MIRT736399	hsa-miR-369-3p	qRT-PCRFlow cytometry	33679688
MIRT736410	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT704399	hsa-miR-8066	HITS-CLIP	23313552
MIRT704398	hsa-miR-3622a-3p	HITS-CLIP	23313552
MIRT704397	hsa-miR-3622b-3p	HITS-CLIP	23313552
MIRT704396	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT704395	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT704394	hsa-miR-4459	HITS-CLIP	23313552
MIRT704393	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT704392	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT704391	hsa-miR-544b	HITS-CLIP	23313552
MIRT704390	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT704389	hsa-miR-4794	HITS-CLIP	23313552
MIRT704388	hsa-miR-664a-5p	HITS-CLIP	23313552
MIRT704387	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT704386	hsa-miR-769-5p	HITS-CLIP	23313552
MIRT704385	hsa-miR-3672	HITS-CLIP	23313552
MIRT704384	hsa-miR-6864-3p	HITS-CLIP	23313552
MIRT916015	hsa-miR-1182	CLIP-seq
MIRT916016	hsa-miR-122	CLIP-seq
MIRT916017	hsa-miR-1299	CLIP-seq
MIRT916018	hsa-miR-193a-5p	CLIP-seq
MIRT916019	hsa-miR-214	CLIP-seq
MIRT916020	hsa-miR-3120-3p	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT916022	hsa-miR-3182	CLIP-seq
MIRT916023	hsa-miR-3194-3p	CLIP-seq
MIRT916024	hsa-miR-3619-5p	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916027	hsa-miR-3664-5p	CLIP-seq
MIRT916028	hsa-miR-431	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT916030	hsa-miR-4477a	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT916032	hsa-miR-4659a-3p	CLIP-seq
MIRT916033	hsa-miR-4659b-3p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT916035	hsa-miR-4782-5p	CLIP-seq
MIRT916036	hsa-miR-516b	CLIP-seq
MIRT916037	hsa-miR-761	CLIP-seq
MIRT916016	hsa-miR-122	CLIP-seq
MIRT916038	hsa-miR-1275	CLIP-seq
MIRT916039	hsa-miR-135a	CLIP-seq
MIRT916040	hsa-miR-135b	CLIP-seq
MIRT916041	hsa-miR-140-3p	CLIP-seq
MIRT916042	hsa-miR-185	CLIP-seq
MIRT916043	hsa-miR-203	CLIP-seq
MIRT916019	hsa-miR-214	CLIP-seq
MIRT916044	hsa-miR-3122	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT916045	hsa-miR-3150a-3p	CLIP-seq
MIRT916046	hsa-miR-3163	CLIP-seq
MIRT916047	hsa-miR-3175	CLIP-seq
MIRT916023	hsa-miR-3194-3p	CLIP-seq
MIRT916048	hsa-miR-329	CLIP-seq
MIRT916049	hsa-miR-340	CLIP-seq
MIRT916050	hsa-miR-342-5p	CLIP-seq
MIRT916024	hsa-miR-3619-5p	CLIP-seq
MIRT916051	hsa-miR-362-3p	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916052	hsa-miR-3689a-3p	CLIP-seq
MIRT916053	hsa-miR-3689c	CLIP-seq
MIRT916054	hsa-miR-3913-5p	CLIP-seq
MIRT916055	hsa-miR-4269	CLIP-seq
MIRT916056	hsa-miR-4275	CLIP-seq
MIRT916057	hsa-miR-4306	CLIP-seq
MIRT916058	hsa-miR-4314	CLIP-seq
MIRT916059	hsa-miR-4428	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT916060	hsa-miR-4505	CLIP-seq
MIRT916061	hsa-miR-4514	CLIP-seq
MIRT916062	hsa-miR-4525	CLIP-seq
MIRT916063	hsa-miR-4644	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT916064	hsa-miR-4651	CLIP-seq
MIRT916065	hsa-miR-4664-5p	CLIP-seq
MIRT916066	hsa-miR-4665-5p	CLIP-seq
MIRT916067	hsa-miR-4667-5p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT916068	hsa-miR-4690-5p	CLIP-seq
MIRT916069	hsa-miR-4692	CLIP-seq
MIRT916070	hsa-miR-4695-3p	CLIP-seq
MIRT916071	hsa-miR-4700-5p	CLIP-seq
MIRT916072	hsa-miR-4723-5p	CLIP-seq
MIRT916073	hsa-miR-4728-5p	CLIP-seq
MIRT916074	hsa-miR-4731-5p	CLIP-seq
MIRT916075	hsa-miR-4738-3p	CLIP-seq
MIRT916076	hsa-miR-4773	CLIP-seq
MIRT916077	hsa-miR-483-3p	CLIP-seq
MIRT916078	hsa-miR-485-5p	CLIP-seq
MIRT916079	hsa-miR-548g	CLIP-seq
MIRT916080	hsa-miR-604	CLIP-seq
MIRT916081	hsa-miR-608	CLIP-seq
MIRT916082	hsa-miR-625	CLIP-seq
MIRT916083	hsa-miR-637	CLIP-seq
MIRT916084	hsa-miR-647	CLIP-seq
MIRT916037	hsa-miR-761	CLIP-seq
MIRT916085	hsa-miR-939	CLIP-seq
MIRT916016	hsa-miR-122	CLIP-seq
MIRT1971642	hsa-miR-1827	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT1971643	hsa-miR-3545-3p	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT1971644	hsa-miR-3929	CLIP-seq
MIRT1971645	hsa-miR-4267	CLIP-seq
MIRT916056	hsa-miR-4275	CLIP-seq
MIRT1971646	hsa-miR-4419b	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT1971647	hsa-miR-4478	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT1971648	hsa-miR-4649-3p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT1971649	hsa-miR-4680-5p	CLIP-seq
MIRT916070	hsa-miR-4695-3p	CLIP-seq
MIRT1971650	hsa-miR-4722-5p	CLIP-seq
MIRT916078	hsa-miR-485-5p	CLIP-seq
MIRT1971651	hsa-miR-940	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT916068	hsa-miR-4690-5p	CLIP-seq
MIRT916070	hsa-miR-4695-3p	CLIP-seq
MIRT916044	hsa-miR-3122	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916052	hsa-miR-3689a-3p	CLIP-seq
MIRT916053	hsa-miR-3689c	CLIP-seq
MIRT916054	hsa-miR-3913-5p	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT916073	hsa-miR-4728-5p	CLIP-seq
MIRT2465143	hsa-miR-10a	CLIP-seq
MIRT2465144	hsa-miR-10b	CLIP-seq
MIRT2465145	hsa-miR-1268	CLIP-seq
MIRT2465146	hsa-miR-1268b	CLIP-seq
MIRT916044	hsa-miR-3122	CLIP-seq
MIRT2465147	hsa-miR-339-5p	CLIP-seq
MIRT916052	hsa-miR-3689a-3p	CLIP-seq
MIRT916053	hsa-miR-3689c	CLIP-seq
MIRT916054	hsa-miR-3913-5p	CLIP-seq
MIRT2465148	hsa-miR-4421	CLIP-seq
MIRT2465149	hsa-miR-4486	CLIP-seq
MIRT916060	hsa-miR-4505	CLIP-seq
MIRT916073	hsa-miR-4728-5p	CLIP-seq
MIRT916078	hsa-miR-485-5p	CLIP-seq
MIRT2465150	hsa-miR-511	CLIP-seq
MIRT2465151	hsa-miR-548c-3p	CLIP-seq
MIRT2465152	hsa-miR-585	CLIP-seq
MIRT2510555	hsa-miR-103b	CLIP-seq
MIRT2510556	hsa-miR-106a	CLIP-seq
MIRT2510557	hsa-miR-106b	CLIP-seq
MIRT2465143	hsa-miR-10a	CLIP-seq
MIRT2465144	hsa-miR-10b	CLIP-seq
MIRT916015	hsa-miR-1182	CLIP-seq
MIRT916016	hsa-miR-122	CLIP-seq
MIRT2465145	hsa-miR-1268	CLIP-seq
MIRT2465146	hsa-miR-1268b	CLIP-seq
MIRT2510558	hsa-miR-1279	CLIP-seq
MIRT916017	hsa-miR-1299	CLIP-seq
MIRT2510559	hsa-miR-1323	CLIP-seq
MIRT2510560	hsa-miR-150	CLIP-seq
MIRT2510561	hsa-miR-17	CLIP-seq
MIRT916018	hsa-miR-193a-5p	CLIP-seq
MIRT2510562	hsa-miR-20a	CLIP-seq
MIRT2510563	hsa-miR-20b	CLIP-seq
MIRT916019	hsa-miR-214	CLIP-seq
MIRT2510564	hsa-miR-302a	CLIP-seq
MIRT2510565	hsa-miR-302b	CLIP-seq
MIRT2510566	hsa-miR-302c	CLIP-seq
MIRT2510567	hsa-miR-302d	CLIP-seq
MIRT2510568	hsa-miR-302e	CLIP-seq
MIRT916020	hsa-miR-3120-3p	CLIP-seq
MIRT916044	hsa-miR-3122	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT2510569	hsa-miR-3148	CLIP-seq
MIRT916022	hsa-miR-3182	CLIP-seq
MIRT916023	hsa-miR-3194-3p	CLIP-seq
MIRT2465147	hsa-miR-339-5p	CLIP-seq
MIRT2510570	hsa-miR-3613-3p	CLIP-seq
MIRT2510571	hsa-miR-3617	CLIP-seq
MIRT916024	hsa-miR-3619-5p	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916027	hsa-miR-3664-5p	CLIP-seq
MIRT916052	hsa-miR-3689a-3p	CLIP-seq
MIRT916053	hsa-miR-3689c	CLIP-seq
MIRT2510572	hsa-miR-371-5p	CLIP-seq
MIRT2510573	hsa-miR-371b-5p	CLIP-seq
MIRT2510574	hsa-miR-372	CLIP-seq
MIRT2510575	hsa-miR-373	CLIP-seq
MIRT916054	hsa-miR-3913-5p	CLIP-seq
MIRT2510576	hsa-miR-3940-5p	CLIP-seq
MIRT2510577	hsa-miR-3977	CLIP-seq
MIRT2510578	hsa-miR-423-3p	CLIP-seq
MIRT916028	hsa-miR-431	CLIP-seq
MIRT2465148	hsa-miR-4421	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT2510579	hsa-miR-4438	CLIP-seq
MIRT2465149	hsa-miR-4486	CLIP-seq
MIRT2510580	hsa-miR-4507	CLIP-seq
MIRT2510581	hsa-miR-4638-5p	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT916032	hsa-miR-4659a-3p	CLIP-seq
MIRT916033	hsa-miR-4659b-3p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT916070	hsa-miR-4695-3p	CLIP-seq
MIRT2510582	hsa-miR-4714-3p	CLIP-seq
MIRT916073	hsa-miR-4728-5p	CLIP-seq
MIRT2510583	hsa-miR-4735-5p	CLIP-seq
MIRT2510584	hsa-miR-4775	CLIP-seq
MIRT916035	hsa-miR-4782-5p	CLIP-seq
MIRT2510585	hsa-miR-4797-5p	CLIP-seq
MIRT2510586	hsa-miR-494	CLIP-seq
MIRT2510587	hsa-miR-501-3p	CLIP-seq
MIRT2510588	hsa-miR-502-3p	CLIP-seq
MIRT2510589	hsa-miR-5095	CLIP-seq
MIRT2465150	hsa-miR-511	CLIP-seq
MIRT916036	hsa-miR-516b	CLIP-seq
MIRT2510590	hsa-miR-519d	CLIP-seq
MIRT2510591	hsa-miR-520a-3p	CLIP-seq
MIRT2510592	hsa-miR-520b	CLIP-seq
MIRT2510593	hsa-miR-520c-3p	CLIP-seq
MIRT2510594	hsa-miR-520d-3p	CLIP-seq
MIRT2510595	hsa-miR-520e	CLIP-seq
MIRT2510596	hsa-miR-520f	CLIP-seq
MIRT2510597	hsa-miR-526b	CLIP-seq
MIRT2510598	hsa-miR-548a-3p	CLIP-seq
MIRT2465151	hsa-miR-548c-3p	CLIP-seq
MIRT2510599	hsa-miR-548e	CLIP-seq
MIRT2510600	hsa-miR-548f	CLIP-seq
MIRT2510601	hsa-miR-548o	CLIP-seq
MIRT2510602	hsa-miR-562	CLIP-seq
MIRT2510603	hsa-miR-578	CLIP-seq
MIRT2465152	hsa-miR-585	CLIP-seq
MIRT2510604	hsa-miR-590-3p	CLIP-seq
MIRT2510605	hsa-miR-635	CLIP-seq
MIRT2510606	hsa-miR-641	CLIP-seq
MIRT2510607	hsa-miR-642b	CLIP-seq
MIRT916037	hsa-miR-761	CLIP-seq
MIRT2510608	hsa-miR-767-5p	CLIP-seq
MIRT2510609	hsa-miR-93	CLIP-seq
MIRT2510610	hsa-miR-944	CLIP-seq
MIRT2510555	hsa-miR-103b	CLIP-seq
MIRT2465143	hsa-miR-10a	CLIP-seq
MIRT2465144	hsa-miR-10b	CLIP-seq
MIRT916015	hsa-miR-1182	CLIP-seq
MIRT2678806	hsa-miR-1200	CLIP-seq
MIRT916016	hsa-miR-122	CLIP-seq
MIRT916017	hsa-miR-1299	CLIP-seq
MIRT2510559	hsa-miR-1323	CLIP-seq
MIRT916018	hsa-miR-193a-5p	CLIP-seq
MIRT916019	hsa-miR-214	CLIP-seq
MIRT916020	hsa-miR-3120-3p	CLIP-seq
MIRT916044	hsa-miR-3122	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT2510569	hsa-miR-3148	CLIP-seq
MIRT916022	hsa-miR-3182	CLIP-seq
MIRT916023	hsa-miR-3194-3p	CLIP-seq
MIRT2465147	hsa-miR-339-5p	CLIP-seq
MIRT2510570	hsa-miR-3613-3p	CLIP-seq
MIRT2510571	hsa-miR-3617	CLIP-seq
MIRT916024	hsa-miR-3619-5p	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916027	hsa-miR-3664-5p	CLIP-seq
MIRT916052	hsa-miR-3689a-3p	CLIP-seq
MIRT916053	hsa-miR-3689c	CLIP-seq
MIRT2510572	hsa-miR-371-5p	CLIP-seq
MIRT2510573	hsa-miR-371b-5p	CLIP-seq
MIRT916054	hsa-miR-3913-5p	CLIP-seq
MIRT2510576	hsa-miR-3940-5p	CLIP-seq
MIRT916028	hsa-miR-431	CLIP-seq
MIRT2678807	hsa-miR-4324	CLIP-seq
MIRT2465148	hsa-miR-4421	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT2510580	hsa-miR-4507	CLIP-seq
MIRT2678808	hsa-miR-450b-5p	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT916032	hsa-miR-4659a-3p	CLIP-seq
MIRT916033	hsa-miR-4659b-3p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT916070	hsa-miR-4695-3p	CLIP-seq
MIRT2510582	hsa-miR-4714-3p	CLIP-seq
MIRT916073	hsa-miR-4728-5p	CLIP-seq
MIRT916035	hsa-miR-4782-5p	CLIP-seq
MIRT2510585	hsa-miR-4797-5p	CLIP-seq
MIRT916078	hsa-miR-485-5p	CLIP-seq
MIRT2510586	hsa-miR-494	CLIP-seq
MIRT2465150	hsa-miR-511	CLIP-seq
MIRT916036	hsa-miR-516b	CLIP-seq
MIRT2678809	hsa-miR-518a-5p	CLIP-seq
MIRT2678810	hsa-miR-527	CLIP-seq
MIRT2510598	hsa-miR-548a-3p	CLIP-seq
MIRT2465151	hsa-miR-548c-3p	CLIP-seq
MIRT2510599	hsa-miR-548e	CLIP-seq
MIRT2510600	hsa-miR-548f	CLIP-seq
MIRT2510601	hsa-miR-548o	CLIP-seq
MIRT2510605	hsa-miR-635	CLIP-seq
MIRT2510606	hsa-miR-641	CLIP-seq
MIRT2510607	hsa-miR-642b	CLIP-seq
MIRT916037	hsa-miR-761	CLIP-seq
MIRT2510610	hsa-miR-944	CLIP-seq

Transcription factor	Regulation	Reference
SPI1	Activation	16365419

57 Show/Hide all (57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001968	Function	Fibronectin binding	IEA
GO:0001968	Function	Fibronectin binding	IPI	22952693
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002250	Process	Adaptive immune response	IEP	15196205
GO:0002577	Process	Regulation of antigen processing and presentation	IDA	22365146
GO:0004197	Function	Cysteine-type endopeptidase activity	IBA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	8612130, 12788072, 22952693
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	1373132
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	15752368, 22365146
GO:0005518	Function	Collagen binding	IDA	22952693
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9524075, 22952693
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	15196205
GO:0005764	Component	Lysosome	IEA
GO:0005770	Component	Late endosome	IDA	22365146
GO:0006508	Process	Proteolysis	IDA	12788072, 22864553
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	1373132
GO:0006955	Process	Immune response	TAS	8157683
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IDA	15752368, 22365146
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0010447	Process	Response to acidic pH	IDA	22864553
GO:0016485	Process	Protein processing	IDA	22864553
GO:0016787	Function	Hydrolase activity	IEA
GO:0019882	Process	Antigen processing and presentation	TAS	15196205
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	30612035
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0022617	Process	Extracellular matrix disassembly	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030574	Process	Collagen catabolic process	IDA	22952693
GO:0030574	Process	Collagen catabolic process	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28344315
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034769	Process	Basement membrane disassembly	IDA	22952693
GO:0036021	Component	Endolysosome lumen	IEA
GO:0036021	Component	Endolysosome lumen	TAS
GO:0043202	Component	Lysosomal lumen	TAS
GO:0043236	Function	Laminin binding	IDA	22952693
GO:0043394	Function	Proteoglycan binding	IEA
GO:0043394	Function	Proteoglycan binding	IPI	22952693
GO:0045335	Component	Phagocytic vesicle	IDA	30612035
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0048002	Process	Antigen processing and presentation of peptide antigen	IDA	8612130
GO:0051603	Process	Proteolysis involved in protein catabolic process	IBA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IDA	22952693
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IEP	21217776
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2001259	Process	Positive regulation of cation channel activity	IDA	22864553

MIM	HGNC	e!Ensembl
116845	2545	ENSG00000163131

P25774

Protein name

Cathepsin S (EC 3.4.22.27)

Protein function

Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules and MHC class II antigen presentation (PubMed:30612035). The bond-specificity of this proteinase is in part similar to the specificities

PDB

1GLO , 1MS6 , 1NPZ , 1NQC , 2C0Y , 2F1G , 2FQ9 , 2FRA , 2FRQ , 2FT2 , 2FUD , 2FYE , 2G6D , 2G7Y , 2H7J , 2HH5 , 2HHN , 2HXZ , 2OP3 , 2R9M , 2R9N , 2R9O , 3IEJ , 3N3G , 3N4C , 3OVX , 4P6E , 4P6G , 5QBU , 5QBV , 5QBW , 5QBX , 5QBY , 5QBZ , 5QC0 , 5QC1 , 5QC2 , 5QC3 , 5QC4 , 5QC5 , 5QC6 , 5QC7 , 5QC8 , 5QC9 , 5QCA , 5QCB , 5QCC , 5QCD , 5QCE , 5QCF , 5QCG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00112	Peptidase_C1	115 → 330	Papain family cysteine protease	Domain
PF08246	Inhibitor_I29	28 → 88	Cathepsin propeptide inhibitor domain (I29)	Domain

Sequence

MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI

Sequence length

331

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Lysosome	Degradation of the extracellular matrix
Phagosome	Trafficking and processing of endosomal TLR
Apoptosis	Assembly of collagen fibrils and other multimeric structures
Antigen processing and presentation	MHC class II antigen presentation
Tuberculosis	Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (13)
ATRIAL FIBRILLATION	—	GWAS catalog	40645996	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	31174203, 33549134, 38182794	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	32469254, 36474045, 41022758	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	38182794	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	25724174	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	31604244	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROPATHY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	21156398	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAROXYSMAL TACHYCARDIA	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	36496446, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (162)
Alzheimer Disease	Alzheimer disease	Pubtator	1837142, 39740768, 7575468, 7717452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33892821, 39740768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	18155003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	25301844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17322367, 22804761, 24833013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25301844, 31156336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	29915952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29915952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10721671, 15985526, 21223957, 27595325, 29970364, 30549421, 31115520, 31156336, 31296090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30248434, 31553637, 31729618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	31553637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	37069596	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11920402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20855652, 27249607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27249607, 40615557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	12819022, 19434518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10721671, 15985526, 21223957, 27595325, 29970364, 30549421, 31115520, 31156336, 31296090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32469254, 34925641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28692065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	25348778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Cancer	Basal Cell Neoplasm	GWASCAT_DG	31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	GWASCAT_DG	31174203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Cell Neoplasm	Basal Cell Neoplasm	GWASCAT_DG	31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28033540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27796714, 29181829, 30185799, 30253340, 31346333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27592448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	31461977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28033540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28793886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31438640, 40256740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18565099, 23747398, 28236030, 30848029, 31296090, 31729618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18565099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	27595325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	37878141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	27344170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30341237, 30848029		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28981104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28981104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19307473, 28240259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18410260, 29976774, 30641028, 31553637		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	27344170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30012612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21896304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21989182, 23443137, 29516317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	19307473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31844116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20880494, 28978867, 30261474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28978867, 30261474		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	32469254	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	28978867, 30261474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	28449707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23437289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23437289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	24940638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	24940638, 30655278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	24940638	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11920402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	34208434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30549421, 30581342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31880859	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27858577, 30549421, 30581342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36982499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33062070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37492198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37773794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	7717452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30038391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	36208723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	10961902	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	31358474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	31358474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19434518, 36552871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24875536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24875536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19434518, 9153291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	34819020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27796714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25496327, 31844116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31844116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	29365317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	31115520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	36982499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33062070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29615702, 31017016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28793886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36081453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30012612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35881699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	19307473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22796222, 24523067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	26301107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	24940638, 30641028, 30655278, 31553637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32476947	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39290707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28987592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28987592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29749483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	32396854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27796714, 29181829, 30006610, 30185799, 30253340, 31346333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28793886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28033540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22101325, 23629809, 24875536, 27097645, 27796714, 27927016, 28282545, 29181829, 31115520, 31346333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28981104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18343923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29047110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23747398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23747398, 30549421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39290707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	15661938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29611169	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	12742663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16365041, 18959458, 21896304, 22101325, 23629809, 27097645, 27796714, 28033540, 28282545, 28981104, 30006610, 31346333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25883214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	39740768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24390241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21595995, 28282545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15985526, 18565099, 20164293, 22844403, 30549421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16034612	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	21156398		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	22844403	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	11920402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32176315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	39740768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	29362520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	26334995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28769800, 29362520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	21228734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	21228734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	9066978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	28493068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	31605630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31337649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	34208434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28289191, 31319889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31017016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17878156	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29976774, 31553637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	15944319, 18410260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	LHGDN	18410260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31115520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11920402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	32476947	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	39364409	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	30038391, 30126300, 30423938, 31267034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30423938	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	33062070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Social Communication Disorder	Social Communication Disorder	BEFREE	28623134		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29611169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	24727728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27058412	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35617240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	30038391, 30126300, 30423938, 31267034		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	30038391, 30126300, 30423938, 31267034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28493068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	29365317	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29749483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27796714, 30185799, 31346333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15989693, 31748500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	19273215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	31461977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27595325		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
EDEM2	2	["Cutaneous squamous cell carcinoma","Non-melanoma skin carcinoma"]	0	[]	3	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Cutaneous squamous cell carcinoma)","GWAS catalog (Non-melanoma skin carcinoma)"]
DUSP22	2	["Cutaneous squamous cell carcinoma","Non-melanoma skin carcinoma"]	0	[]	3	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Cutaneous squamous cell carcinoma)","GWAS catalog (Non-melanoma skin carcinoma)"]
CPVL	2	["Cutaneous squamous cell carcinoma","Non-melanoma skin carcinoma"]	0	[]	4	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Melanoma)","GWAS catalog (Cutaneous squamous cell carcinoma)","GWAS catalog (Non-melanoma skin carcinoma)"]
CTSV	0	[]	6	["Lysosome","Apoptosis","MHC class II antigen presentation","Degradation of the extracellular matrix","Trafficking and processing of endosomal TLR","Assembly of collagen fibrils and other multimeric structures"]	0	[]
CTSL	0	[]	8	["Lysosome","Phagosome","Apoptosis","Antigen processing and presentation","MHC class II antigen presentation","Degradation of the extracellular matrix","Trafficking and processing of endosomal TLR","Assembly of collagen fibrils and other multimeric structures"]	0	[]

CTSS (cathepsin S)

Bookmark This Gene