CTSL3P (cathepsin L family member 3, pseudogene)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 392360 |
| Gene name | Cathepsin L family member 3, pseudogene |
| Gene symbol | CTSL3P |
| Synonyms (NCBI Gene) |
CTSL3HCTSL-s
|
| Chromosome | 9 |
| Chromosome location | 9q21.33 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q5NE16 |
| Protein name | Putative inactive cathepsin L-like protein CTSL3P (Cathepsin L3 pseudogene) (HCTSL-s) |
| Family and domains | |
| Sequence |
MKMIEQHNQEYREGKHSFTMAMNAFGEMTSEEFRQVVNGFQNQKHRKGKVLQEPLLHDIR |
| Sequence length | 218 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with CTSL3P across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to CTSL3P (see Related Genes above), that are NOT already directly curated for CTSL3P itself -- a lead worth checking, not a confirmed association.
0
|
|