CTRB1 (chymotrypsinogen B1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 1504
Gene name Chymotrypsinogen B1
Gene symbol CTRB1
Synonyms (NCBI Gene)
CTRB
Chromosome 16
Chromosome location 16q23.1
Summary This gene encodes a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. The encoded preproprotein is synthesized in the acinar cells of the pancreas and secreted into the small intestine w
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017949 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004252 Function Serine-type endopeptidase activity IBA
GO:0004252 Function Serine-type endopeptidase activity IEA
GO:0004252 Function Serine-type endopeptidase activity NAS 2917002
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
118890 2521 ENSG00000168925
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P17538
Protein name Chymotrypsinogen B (EC 3.4.21.1) [Cleaved into: Chymotrypsin B chain A; Chymotrypsin B chain B; Chymotrypsin B chain C]
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00089 Trypsin 34 → 256 Trypsin Domain
Sequence 
MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
Sequence length 263
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Pancreatic secretion Activation of Matrix Metalloproteinases
Protein digestion and absorption Cobalamin (Cbl, vitamin B12) transport and metabolism
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (8)
Phenotype Name Clinical Significance Source Reference Evidence Score
CORONARY ARTERY DISEASE — GWAS catalog 38062574
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS — GWAS catalog 39024449, 39789286
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPOXIA — CTD 19579223
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME — GWAS catalog 39349817
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA — GWAS catalog 37340002
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (21)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Age related macular degeneration Age-related macular degeneration BEFREE 28011711, 29346644
★★★★★
★☆☆☆☆
Found in Text Mining only
Coronary Arteriosclerosis Coronary Arteriosclerosis BEFREE 30858448
★★★★★
★☆☆☆☆
Found in Text Mining only
Coronary Artery Disease Coronary artery disease Pubtator 30858448 Associate
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease Coronary artery disease BEFREE 30858448
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Coronary heart disease Coronary Heart Disease BEFREE 30858448
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Diabetes BEFREE 23674605
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Diabetes mellitus Pubtator 23674605 Associate
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Diabetes Mellitus BEFREE 23674605
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus GWASDB_DG 22885922
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 29302047
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
CTRB2 2 shared diseasesDiabetes mellitus, Pancreatic cancer 4 shared pathwaysPancreatic secretion, Protein digestion and absorption, Activation of Matrix Metalloproteinases, Cobalamin (Cbl, vitamin B12) transport and metabolism 2 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Pancreatic cancer) Related via 4 shared pathways including Pancreatic secretion, Protein digestion and absorption — evidence mostly GWAS catalog. ZFP1 2 shared diseasesDiabetes mellitus, Pancreatic cancer 2 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Pancreatic cancer) Related via 2 shared diseases including Diabetes mellitus, Pancreatic cancer — evidence mostly GWAS catalog. BCAR1 2 shared diseasesDiabetes mellitus, Pancreatic cancer 2 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Pancreatic cancer) Related via 2 shared diseases including Diabetes mellitus, Pancreatic cancer — evidence mostly GWAS catalog. PRSS1 4 shared pathwaysPancreatic secretion, Protein digestion and absorption, Activation of Matrix Metalloproteinases, Cobalamin (Cbl, vitamin B12) transport and metabolism Related via 4 shared pathways including Pancreatic secretion, Protein digestion and absorption. RCCD1 2 shared diseasesDiabetes mellitus, Pancreatic cancer 2 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Pancreatic cancer) Related via 2 shared diseases including Diabetes mellitus, Pancreatic cancer — evidence mostly GWAS catalog.
Atrophic macular degeneration Linked via 2 of 5 related genesCTRB2, ZFP1 Diabetic neuropathy Linked via 2 of 5 related genesCTRB2, ZFP1 Age-related macular degeneration Linked via 2 of 5 related genesCTRB2, ZFP1 Migraine Linked via 2 of 5 related genesBCAR1, RCCD1 Pancreatic neoplasms Linked via 2 of 5 related genesBCAR1, PRSS1