Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	9811
Gene name	Cap binding complex dependent translation initiation factor
Gene symbol	CTIF
Synonyms (NCBI Gene)	Gm672KIAA0427
Chromosome	18
Chromosome location	18q21.1
Summary	CTIF is a component of the CBP80 (NCBP1; MIM 600469)/CBP20 (NCBP2; MIM 605133) translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step

261 Show/Hide all (261)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037103	hsa-miR-877-3p	CLASH	23622248
MIRT659281	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT659280	hsa-miR-5193	HITS-CLIP	23824327
MIRT659279	hsa-miR-18a-3p	HITS-CLIP	23824327
MIRT659278	hsa-miR-4290	HITS-CLIP	23824327
MIRT659277	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT659276	hsa-miR-1976	HITS-CLIP	23824327
MIRT447838	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT447837	hsa-miR-3139	PAR-CLIP	22100165
MIRT447836	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT447835	hsa-miR-4436b-3p	PAR-CLIP	22100165
MIRT447834	hsa-miR-4632-5p	PAR-CLIP	22100165
MIRT447833	hsa-miR-6735-5p	PAR-CLIP	22100165
MIRT447832	hsa-miR-6879-5p	PAR-CLIP	22100165
MIRT447831	hsa-miR-7843-5p	PAR-CLIP	22100165
MIRT447830	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT447829	hsa-miR-3150b-3p	PAR-CLIP	22100165
MIRT447828	hsa-miR-4784	PAR-CLIP	22100165
MIRT447827	hsa-miR-765	PAR-CLIP	22100165
MIRT447826	hsa-miR-34a-5p	PAR-CLIP	22100165
MIRT447825	hsa-miR-34c-5p	PAR-CLIP	22100165
MIRT447824	hsa-miR-449a	PAR-CLIP	22100165
MIRT447823	hsa-miR-449b-5p	PAR-CLIP	22100165
MIRT447822	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT447820	hsa-miR-4689	PAR-CLIP	22100165
MIRT447821	hsa-miR-6858-5p	PAR-CLIP	22100165
MIRT447819	hsa-miR-3147	PAR-CLIP	22100165
MIRT659281	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT659280	hsa-miR-5193	HITS-CLIP	23824327
MIRT659279	hsa-miR-18a-3p	HITS-CLIP	23824327
MIRT659278	hsa-miR-4290	HITS-CLIP	23824327
MIRT659277	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT659276	hsa-miR-1976	HITS-CLIP	23824327
MIRT447838	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT447837	hsa-miR-3139	PAR-CLIP	22100165
MIRT447836	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT447835	hsa-miR-4436b-3p	PAR-CLIP	22100165
MIRT447834	hsa-miR-4632-5p	PAR-CLIP	22100165
MIRT447833	hsa-miR-6735-5p	PAR-CLIP	22100165
MIRT447832	hsa-miR-6879-5p	PAR-CLIP	22100165
MIRT447831	hsa-miR-7843-5p	PAR-CLIP	22100165
MIRT447830	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT447829	hsa-miR-3150b-3p	PAR-CLIP	22100165
MIRT447828	hsa-miR-4784	PAR-CLIP	22100165
MIRT447827	hsa-miR-765	PAR-CLIP	22100165
MIRT447826	hsa-miR-34a-5p	PAR-CLIP	22100165
MIRT447825	hsa-miR-34c-5p	PAR-CLIP	22100165
MIRT447824	hsa-miR-449a	PAR-CLIP	22100165
MIRT447823	hsa-miR-449b-5p	PAR-CLIP	22100165
MIRT447822	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT447820	hsa-miR-4689	PAR-CLIP	22100165
MIRT447821	hsa-miR-6858-5p	PAR-CLIP	22100165
MIRT447819	hsa-miR-3147	PAR-CLIP	22100165
MIRT914749	hsa-let-7a	CLIP-seq
MIRT914750	hsa-let-7b	CLIP-seq
MIRT914751	hsa-let-7c	CLIP-seq
MIRT914752	hsa-let-7d	CLIP-seq
MIRT914753	hsa-let-7e	CLIP-seq
MIRT914754	hsa-let-7f	CLIP-seq
MIRT914755	hsa-let-7g	CLIP-seq
MIRT914756	hsa-let-7i	CLIP-seq
MIRT914757	hsa-miR-1181	CLIP-seq
MIRT914758	hsa-miR-2110	CLIP-seq
MIRT914759	hsa-miR-221	CLIP-seq
MIRT914760	hsa-miR-222	CLIP-seq
MIRT914761	hsa-miR-2355-3p	CLIP-seq
MIRT914762	hsa-miR-31	CLIP-seq
MIRT914763	hsa-miR-3120-5p	CLIP-seq
MIRT914764	hsa-miR-3150a-3p	CLIP-seq
MIRT914765	hsa-miR-3151	CLIP-seq
MIRT914766	hsa-miR-3175	CLIP-seq
MIRT914767	hsa-miR-3182	CLIP-seq
MIRT914768	hsa-miR-3189-3p	CLIP-seq
MIRT914769	hsa-miR-3194-3p	CLIP-seq
MIRT914770	hsa-miR-3197	CLIP-seq
MIRT914771	hsa-miR-326	CLIP-seq
MIRT914772	hsa-miR-330-5p	CLIP-seq
MIRT914773	hsa-miR-3687	CLIP-seq
MIRT914774	hsa-miR-3688-5p	CLIP-seq
MIRT914775	hsa-miR-3909	CLIP-seq
MIRT914776	hsa-miR-4274	CLIP-seq
MIRT914777	hsa-miR-4303	CLIP-seq
MIRT914778	hsa-miR-4315	CLIP-seq
MIRT914779	hsa-miR-4421	CLIP-seq
MIRT914780	hsa-miR-4436b-5p	CLIP-seq
MIRT914781	hsa-miR-4442	CLIP-seq
MIRT914782	hsa-miR-4446-3p	CLIP-seq
MIRT914783	hsa-miR-4447	CLIP-seq
MIRT914784	hsa-miR-4458	CLIP-seq
MIRT914785	hsa-miR-4468	CLIP-seq
MIRT914786	hsa-miR-4472	CLIP-seq
MIRT914787	hsa-miR-4476	CLIP-seq
MIRT914788	hsa-miR-4500	CLIP-seq
MIRT914789	hsa-miR-4519	CLIP-seq
MIRT914790	hsa-miR-4667-5p	CLIP-seq
MIRT914791	hsa-miR-4675	CLIP-seq
MIRT914792	hsa-miR-4676-5p	CLIP-seq
MIRT914793	hsa-miR-4686	CLIP-seq
MIRT914794	hsa-miR-4700-5p	CLIP-seq
MIRT914795	hsa-miR-4728-5p	CLIP-seq
MIRT914796	hsa-miR-4741	CLIP-seq
MIRT914797	hsa-miR-4786-3p	CLIP-seq
MIRT914798	hsa-miR-486-3p	CLIP-seq
MIRT914799	hsa-miR-491-5p	CLIP-seq
MIRT914800	hsa-miR-498	CLIP-seq
MIRT914801	hsa-miR-518e	CLIP-seq
MIRT914802	hsa-miR-548v	CLIP-seq
MIRT914803	hsa-miR-575	CLIP-seq
MIRT914804	hsa-miR-637	CLIP-seq
MIRT914805	hsa-miR-671-5p	CLIP-seq
MIRT914806	hsa-miR-676	CLIP-seq
MIRT914807	hsa-miR-939	CLIP-seq
MIRT914808	hsa-miR-98	CLIP-seq
MIRT914749	hsa-let-7a	CLIP-seq
MIRT914750	hsa-let-7b	CLIP-seq
MIRT914751	hsa-let-7c	CLIP-seq
MIRT914752	hsa-let-7d	CLIP-seq
MIRT914753	hsa-let-7e	CLIP-seq
MIRT914754	hsa-let-7f	CLIP-seq
MIRT914755	hsa-let-7g	CLIP-seq
MIRT914756	hsa-let-7i	CLIP-seq
MIRT914809	hsa-miR-1193	CLIP-seq
MIRT914764	hsa-miR-3150a-3p	CLIP-seq
MIRT914766	hsa-miR-3175	CLIP-seq
MIRT914769	hsa-miR-3194-3p	CLIP-seq
MIRT914771	hsa-miR-326	CLIP-seq
MIRT914772	hsa-miR-330-5p	CLIP-seq
MIRT914784	hsa-miR-4458	CLIP-seq
MIRT914788	hsa-miR-4500	CLIP-seq
MIRT914810	hsa-miR-4666-5p	CLIP-seq
MIRT914790	hsa-miR-4667-5p	CLIP-seq
MIRT914794	hsa-miR-4700-5p	CLIP-seq
MIRT914811	hsa-miR-4802-3p	CLIP-seq
MIRT914812	hsa-miR-490-5p	CLIP-seq
MIRT914804	hsa-miR-637	CLIP-seq
MIRT914807	hsa-miR-939	CLIP-seq
MIRT914808	hsa-miR-98	CLIP-seq
MIRT1971359	hsa-miR-1202	CLIP-seq
MIRT1971360	hsa-miR-1228	CLIP-seq
MIRT914762	hsa-miR-31	CLIP-seq
MIRT1971361	hsa-miR-3130-5p	CLIP-seq
MIRT1971362	hsa-miR-3138	CLIP-seq
MIRT1971363	hsa-miR-3144-5p	CLIP-seq
MIRT914764	hsa-miR-3150a-3p	CLIP-seq
MIRT914766	hsa-miR-3175	CLIP-seq
MIRT1971364	hsa-miR-3184	CLIP-seq
MIRT1971365	hsa-miR-3202	CLIP-seq
MIRT1971366	hsa-miR-34a	CLIP-seq
MIRT1971367	hsa-miR-3619-3p	CLIP-seq
MIRT1971368	hsa-miR-3649	CLIP-seq
MIRT1971369	hsa-miR-3911	CLIP-seq
MIRT1971370	hsa-miR-3918	CLIP-seq
MIRT1971371	hsa-miR-3972	CLIP-seq
MIRT1971372	hsa-miR-423-5p	CLIP-seq
MIRT914782	hsa-miR-4446-3p	CLIP-seq
MIRT914787	hsa-miR-4476	CLIP-seq
MIRT1971373	hsa-miR-4482	CLIP-seq
MIRT1971374	hsa-miR-449b	CLIP-seq
MIRT1971375	hsa-miR-4505	CLIP-seq
MIRT914790	hsa-miR-4667-5p	CLIP-seq
MIRT914791	hsa-miR-4675	CLIP-seq
MIRT1971376	hsa-miR-4685-5p	CLIP-seq
MIRT914794	hsa-miR-4700-5p	CLIP-seq
MIRT1971377	hsa-miR-4706	CLIP-seq
MIRT914795	hsa-miR-4728-5p	CLIP-seq
MIRT914796	hsa-miR-4741	CLIP-seq
MIRT1971378	hsa-miR-4749-5p	CLIP-seq
MIRT1971379	hsa-miR-4775	CLIP-seq
MIRT1971380	hsa-miR-4776-3p	CLIP-seq
MIRT1971381	hsa-miR-4776-5p	CLIP-seq
MIRT1971382	hsa-miR-4781-5p	CLIP-seq
MIRT1971383	hsa-miR-4800-5p	CLIP-seq
MIRT914798	hsa-miR-486-3p	CLIP-seq
MIRT1971384	hsa-miR-520g	CLIP-seq
MIRT1971385	hsa-miR-520h	CLIP-seq
MIRT1971386	hsa-miR-659	CLIP-seq
MIRT914805	hsa-miR-671-5p	CLIP-seq
MIRT914807	hsa-miR-939	CLIP-seq
MIRT1971387	hsa-miR-943	CLIP-seq
MIRT914809	hsa-miR-1193	CLIP-seq
MIRT1971359	hsa-miR-1202	CLIP-seq
MIRT2206945	hsa-miR-149	CLIP-seq
MIRT2206946	hsa-miR-193a-3p	CLIP-seq
MIRT2206947	hsa-miR-193b	CLIP-seq
MIRT2206948	hsa-miR-22	CLIP-seq
MIRT2206949	hsa-miR-3064-3p	CLIP-seq
MIRT2206950	hsa-miR-3064-5p	CLIP-seq
MIRT914762	hsa-miR-31	CLIP-seq
MIRT914763	hsa-miR-3120-5p	CLIP-seq
MIRT1971361	hsa-miR-3130-5p	CLIP-seq
MIRT2206951	hsa-miR-3155	CLIP-seq
MIRT2206952	hsa-miR-3155b	CLIP-seq
MIRT914766	hsa-miR-3175	CLIP-seq
MIRT2206953	hsa-miR-3667-3p	CLIP-seq
MIRT914775	hsa-miR-3909	CLIP-seq
MIRT2206954	hsa-miR-3915	CLIP-seq
MIRT2206955	hsa-miR-3917	CLIP-seq
MIRT1971370	hsa-miR-3918	CLIP-seq
MIRT2206956	hsa-miR-3928	CLIP-seq
MIRT1971371	hsa-miR-3972	CLIP-seq
MIRT914776	hsa-miR-4274	CLIP-seq
MIRT2206957	hsa-miR-4287	CLIP-seq
MIRT2206958	hsa-miR-4297	CLIP-seq
MIRT914777	hsa-miR-4303	CLIP-seq
MIRT914779	hsa-miR-4421	CLIP-seq
MIRT2206959	hsa-miR-4438	CLIP-seq
MIRT914785	hsa-miR-4468	CLIP-seq
MIRT2206960	hsa-miR-4469	CLIP-seq
MIRT914787	hsa-miR-4476	CLIP-seq
MIRT1971373	hsa-miR-4482	CLIP-seq
MIRT2206961	hsa-miR-4655-3p	CLIP-seq
MIRT2206962	hsa-miR-4685-3p	CLIP-seq
MIRT1971376	hsa-miR-4685-5p	CLIP-seq
MIRT2206963	hsa-miR-4701-5p	CLIP-seq
MIRT2206964	hsa-miR-4705	CLIP-seq
MIRT914795	hsa-miR-4728-5p	CLIP-seq
MIRT2206965	hsa-miR-4763-5p	CLIP-seq
MIRT1971379	hsa-miR-4775	CLIP-seq
MIRT1971380	hsa-miR-4776-3p	CLIP-seq
MIRT2206966	hsa-miR-4794	CLIP-seq
MIRT914811	hsa-miR-4802-3p	CLIP-seq
MIRT2206967	hsa-miR-484	CLIP-seq
MIRT914798	hsa-miR-486-3p	CLIP-seq
MIRT914812	hsa-miR-490-5p	CLIP-seq
MIRT2206968	hsa-miR-548c-3p	CLIP-seq
MIRT2206969	hsa-miR-588	CLIP-seq
MIRT1971386	hsa-miR-659	CLIP-seq
MIRT1971387	hsa-miR-943	CLIP-seq
MIRT1971359	hsa-miR-1202	CLIP-seq
MIRT1971361	hsa-miR-3130-5p	CLIP-seq
MIRT1971371	hsa-miR-3972	CLIP-seq
MIRT1971373	hsa-miR-4482	CLIP-seq
MIRT1971379	hsa-miR-4775	CLIP-seq
MIRT1971380	hsa-miR-4776-3p	CLIP-seq
MIRT1971386	hsa-miR-659	CLIP-seq
MIRT1971387	hsa-miR-943	CLIP-seq
MIRT2436494	hsa-miR-1915	CLIP-seq
MIRT2436495	hsa-miR-2861	CLIP-seq
MIRT1971370	hsa-miR-3918	CLIP-seq
MIRT2436496	hsa-miR-4512	CLIP-seq
MIRT1971376	hsa-miR-4685-5p	CLIP-seq
MIRT2206965	hsa-miR-4763-5p	CLIP-seq
MIRT2436494	hsa-miR-1915	CLIP-seq
MIRT2436495	hsa-miR-2861	CLIP-seq
MIRT1971370	hsa-miR-3918	CLIP-seq
MIRT2436496	hsa-miR-4512	CLIP-seq
MIRT1971376	hsa-miR-4685-5p	CLIP-seq
MIRT2206965	hsa-miR-4763-5p	CLIP-seq
MIRT2447761	hsa-miR-1184	CLIP-seq
MIRT2447762	hsa-miR-128	CLIP-seq
MIRT2447763	hsa-miR-1301	CLIP-seq
MIRT2447764	hsa-miR-146b-3p	CLIP-seq
MIRT2447765	hsa-miR-3126-5p	CLIP-seq
MIRT2447766	hsa-miR-3173-5p	CLIP-seq
MIRT2447767	hsa-miR-371b-3p	CLIP-seq
MIRT2447768	hsa-miR-4419a	CLIP-seq
MIRT2447769	hsa-miR-4510	CLIP-seq
MIRT2447770	hsa-miR-4660	CLIP-seq
MIRT2447771	hsa-miR-5047	CLIP-seq
MIRT2447772	hsa-miR-874	CLIP-seq
MIRT2510191	hsa-miR-4275	CLIP-seq

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000184	Process	Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA
GO:0000184	Process	Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IMP	19648179
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	19648179, 28514442, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006417	Process	Regulation of translation	IEA
GO:0006446	Process	Regulation of translational initiation	IBA
GO:0006446	Process	Regulation of translational initiation	IMP	19648179
GO:0008494	Function	Translation activator activity	IBA
GO:0045727	Process	Positive regulation of translation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19648179
GO:0048471	Component	Perinuclear region of cytoplasm	IEA

MIM	HGNC	e!Ensembl
613178	23925	ENSG00000134030

O43310

Protein name

CBP80/20-dependent translation initiation factor

Protein function

Specifically required for the pioneer round of mRNA translation mediated by the cap-binding complex (CBC), that takes place during or right after mRNA export via the nuclear pore complex (NPC). Acts via its interaction with the NCBP1/CBP80 compo

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02854	MIF4G	373 → 577	MIF4G domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:19648179}.

Sequence

MENSSAASASSEAGSSRSQEIEELERFIDSYVLEYQVQGLLADKTEGDGESERTQSHISQ
WTADCSEPLDSSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL
DFTQFHRKVRHTPKQPLPHIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEI
AHTKKLFRRRRNDRRRQQRPPGGNKPQQHGDHQPGSAKHNRDHQKSYQGGSAPHPSGRPT
HHGYSQNRRWHHGNMKHPPGDKGEAGAHRNAKETMTIENPKLEDTAGDTGHSSLEAPRSP
DTLAPVASERLPPQQSGGPEVETKRKDSILPERIGERPKITLLQSSKDRLRRRLKEKDEV
AVETTTPQQNKMDKLIEILNSMRNNSSDVDTKLTTFMEEAQNSTNSEEMLGEIVRTIYQK
AVSDRSFAFTAAKLCDKMALFMVEGTKFRSLLLNMLQKDFTVREELQQQDVERWLGFITF
LCEVFGTMRSSTGEPFRVLVCPIYTCLRELLQSQDVKEDAVLCCSMELQSTGRLLEEQLP
EMMTELLASARDKMLCPSESMLTRSLLLEVIELHANSWNPLTPPITQYYNRTIQKLTA

Sequence length

598

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (20)
Acute myeloid leukemia	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	30573740	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	34116867	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	38538606, 38872215	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	23128233, 26192919, 28067908, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	39406924	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	23128233, 26192919, 28067908, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	23793025, 36292730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA	—	GWAS catalog	23793025	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	30891314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	36292730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	23128233, 26192919, 28067908, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	18676749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	GWASDB_DG	17052657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	21926974		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with CTIF across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CTIF.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CTIF (see Related Genes above), that are NOT already directly curated for CTIF itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CTIF.

CTIF (cap binding complex dependent translation initiation factor)

Bookmark This Gene