CTAGE3P (CTAGE family member 3, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 220112
Gene name CTAGE family member 3, pseudogene
Gene symbol CTAGE3P
Synonyms (NCBI Gene)
CTAGE-3CTAGE3
Chromosome 13
Chromosome location 13q14.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005575 Component Cellular_component ND
GO:0008150 Process Biological_process ND
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
608857 24348 ENSG00000232872
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IX95
Protein name Putative cTAGE family member 3 (Protein cTAGE-3)
Protein function Tumor-associated antigen.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in normal tissues including colon, mammary gland, ovary, placenta, stomach and testis, as well as several fetal tissues. {ECO:0000269|PubMed:12839582}.
Sequence 
MTFKGFQMNEEKLEIGIQDASSENCQLQESQKQLLQEAEVWKEQVSELNKQKITFEDSKV
HAEQVLNDKENHIETLTERLLKIKDQAAVLEEDITDDGNLELEMNSELKDGAYLDNPPKG
ALKKLIHAAKLNASLTTLEGERNQFIFSYLKLIKPGRA
Sequence length 158
Interactions View interactions

No strongly related genes found yet for CTAGE3P.

No additional diseases found yet through genes similar to CTAGE3P.