CTAG2 (cancer/testis antigen 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 30848
Gene name Cancer/testis antigen 2
Gene symbol CTAG2
Synonyms (NCBI Gene)
CAMELCT2CT6.2CT6.2aCT6.2bESO2LAGE-1LAGE2B
Chromosome X
Chromosome location Xq28
Summary This gene encodes an autoimmunogenic tumor antigen that belongs to the ESO/LAGE family of cancer-testis antigens. This protein is expressed in a wide array of cancers including melanoma, breast cancer, bladder cancer and prostate cancer. This protein is a
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183
GO:0005813 Component Centrosome IDA
GO:0070525 Process TRNA threonylcarbamoyladenosine metabolic process IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300396 2492 ENSG00000126890
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75638
Protein name Cancer/testis antigen 2 (CT2) (Autoimmunogenic cancer/testis antigen NY-ESO-2) (Cancer/testis antigen 6.2) (CT6.2) (L antigen family member 1) (LAGE-1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09341 Pcc1 89 → 150 Transcription factor Pcc1 Family
Tissue specificity TISSUE SPECIFICITY: Testis and very low level in placenta and in some uterus samples. Observed in 25-50% of tumor samples of melanomas, non-small-cell lung carcinomas, bladder, prostate and head and neck cancers.
Sequence 
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGA
PRGPHGGAASAQDGRCPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPG
AVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRP
GTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Sequence length 210
Interactions View interactions

No strongly related genes found yet for CTAG2.

No additional diseases found yet through genes similar to CTAG2.