CT83 (cancer/testis antigen 83)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 203413
Gene name Cancer/testis antigen 83
Gene symbol CT83
Synonyms (NCBI Gene)
CXorf61KK-LC-1KKLC1
Chromosome X
Chromosome location Xq23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus HDA 21630459
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300625 33494 ENSG00000204019
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5H943
Protein name Kita-kyushu lung cancer antigen 1 (KK-LC-1) (Cancer/testis antigen 83)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15204 KKLCAg1 25 → 111 Kita-kyushu lung cancer antigen 1 Family
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in testis. Expressed by cancer cell lines. {ECO:0000269|PubMed:16651449}.
Sequence 
MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVY
DLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Sequence length 113
Interactions View interactions

No strongly related genes found yet for CT83.

No additional diseases found yet through genes similar to CT83.