Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	54967
Gene name	Cancer/testis antigen 55
Gene symbol	CT55
Synonyms (NCBI Gene)	BJHCC20ACXorf48SPGFX7
Chromosome	X
Chromosome location	Xq26.3

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IDA	36481789
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 36481789
GO:0005737	Component	Cytoplasm	IDA	36481789
GO:0005737	Component	Cytoplasm	IEA
GO:0005929	Component	Cilium	IEA
GO:0007283	Process	Spermatogenesis	IMP	36481789
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0036126	Component	Sperm flagellum	IDA	36481789
GO:0042995	Component	Cell projection	IEA

MIM	HGNC	e!Ensembl
301105	26047	ENSG00000169551

Q8WUE5

Protein name

Cancer/testis antigen 55 (Tumor antigen BJ-HCC-20)

Protein function

Plays a role in spermatogenesis, possibly acting in the regulation of the autophagy pathway.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14444	S1-like	37 → 87	S1-like	Domain
PF14444	S1-like	179 → 235	S1-like	Domain

Tissue specificity

TISSUE SPECIFICITY: Testis-specific (PubMed:15499386). Expressed in spermatozoa (at protein level) (PubMed:36481789). {ECO:0000269|PubMed:15499386, ECO:0000269|PubMed:36481789}.

Sequence

MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFS
SDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTS
INEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPIRCIHTEEV
CITSVHGRNGVIDYTIFFTLDSVKLPDGYVPQVDDIVNVVMVESIQFCFIWRAISITPVH
KSSSGFQDDGGLGRPKRERRSQSI

Sequence length

264

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Spermatogenic failure, X-linked, 7	Pathogenic	rs2523229394	RCV003224650	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MALE INFERTILITY WITH AZOOSPERMIA OR OLIGOZOOSPERMIA DUE TO SINGLE GENE MUTATION	—	Disgenet, Orphanet Disgenet, Orphanet	36481789	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (16)
Astrocytoma	Astrocytoma	BEFREE	19653894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	21285249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17200668, 21285249, 22293751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17200668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30944312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30944312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	17200672		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	17200672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16615912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17200668, 21285249, 22293751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	30944312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30944312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28862699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25564441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	18288683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25564441		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TEX11	2	["Male infertility single gene azoospermia","Spermatogenic failure, x-linked"]	[]	6	["Disgenet (Male infertility single gene azoospermia)","Orphanet (Male infertility single gene azoospermia)","CTD (Spermatogenic failure, x-linked)","ClinVar (Spermatogenic failure, x-linked)","Disgenet (Spermatogenic failure, x-linked)","HPO (Spermatogenic failure, x-linked)"]
GCNA	2	["Male infertility single gene azoospermia","Spermatogenic failure, x-linked"]	[]	5	["Disgenet (Male infertility single gene azoospermia)","Orphanet (Male infertility single gene azoospermia)","ClinVar (Spermatogenic failure, x-linked)","Disgenet (Spermatogenic failure, x-linked)","HPO (Spermatogenic failure, x-linked)"]
USP26	1	["Spermatogenic failure, x-linked"]	[]	3	["ClinVar (Spermatogenic failure, x-linked)","Disgenet (Spermatogenic failure, x-linked)","HPO (Spermatogenic failure, x-linked)"]
CYLC1	1	["Spermatogenic failure, x-linked"]	[]	2	["ClinVar (Spermatogenic failure, x-linked)","Disgenet (Spermatogenic failure, x-linked)"]
SSX1	1	["Spermatogenic failure, x-linked"]	[]	3	["ClinVar (Spermatogenic failure, x-linked)","Disgenet (Spermatogenic failure, x-linked)","HPO (Spermatogenic failure, x-linked)"]

CT55 (cancer/testis antigen 55)

Bookmark This Gene