CT45A3 (cancer/testis antigen family 45 member A3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 441519
Gene name Cancer/testis antigen family 45 member A3
Gene symbol CT45A3
Synonyms (NCBI Gene)
CT45-3CT45-4CT45.3CT45.4CT45A4
Chromosome X
Chromosome location Xq26.3
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2428000 hsa-miR-4685-5p CLIP-seq
MIRT2428001 hsa-miR-4691-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21516116, 25416956, 31515488, 32296183
GO:0005634 Component Nucleus IDA 31429579
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300794 33268 ENSG00000269096
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NHU0
Protein name Cancer/testis antigen family 45 member A3 (Cancer/testis antigen 45-3) (Cancer/testis antigen 45-4) (Cancer/testis antigen 45A3) (Cancer/testis antigen 45A4) (Cancer/testis antigen family 45 member A4)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15300 INT_SG_DDX_CT_C 121 → 183 INTS6/SAGE1/DDX26B/CT45 C-terminus Family
Tissue specificity TISSUE SPECIFICITY: Testis specific. Expressed in cancer cell lines. {ECO:0000269|PubMed:15905330}.
Sequence 
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMT
GHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQR
EINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKH
LKKKLKRMI
Sequence length 189
Interactions View interactions

No strongly related genes found yet for CT45A3.

No additional diseases found yet through genes similar to CT45A3.