CSTL1 (cystatin like 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 128817
Gene name Cystatin like 1
Gene symbol CSTL1
Synonyms (NCBI Gene)
CTES1RCET11dJ322G13.4
Chromosome 20
Chromosome location 20p11.21
Summary The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004869 Function Cysteine-type endopeptidase inhibitor activity IEA
GO:0005576 Component Extracellular region IEA
GO:0008234 Function Cysteine-type peptidase activity IBA
GO:0008234 Function Cysteine-type peptidase activity IEA
GO:0030414 Function Peptidase inhibitor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H114
Protein name Cystatin-like 1 (RCET11)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00031 Cystatin 30 → 123 Cystatin domain Domain
Sequence 
MGIGCWRNPLLLLIALVLSAKLGHFQRWEGFQQKLMSKKNMNSTLNFFIQSYNNASNDTY
LYRVQRLIRSQMQLTTGVEYIVTVKIGWTKCKRNDTSNSSCPLQSKKLRKSLICESLIYT
MPWINYFQLWNNSCLEAEHVGRNLR
Sequence length 145
Interactions View interactions

No strongly related genes found yet for CSTL1.

No additional diseases found yet through genes similar to CSTL1.