CST9L (cystatin 9 like)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 128821
Gene name Cystatin 9 like
Gene symbol CST9L
Synonyms (NCBI Gene)
CTES7BbA218C14.1
Chromosome 20
Chromosome location 20p11.21
Summary The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018903 hsa-miR-335-5p Microarray 18185580
MIRT021779 hsa-miR-132-3p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004869 Function Cysteine-type endopeptidase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0019730 Process Antimicrobial humoral response IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616536 16233 ENSG00000101435
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H4G1
Protein name Cystatin-9-like (Testatin)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00031 Cystatin 39 → 131 Cystatin domain Domain
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in testis. {ECO:0000269|PubMed:11756564, ECO:0000269|PubMed:20565543}.
Sequence 
MLGLPWKGGLSWALLLLLLGSQILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQ
QSKDYYAYRLGHILNSWKEQVESKTVFSMELLLGRTRCGKFEDDIDNCHFQESTELNNTF
TCFFTISTRPWMTQFSLLNKTCLEGFH
Sequence length 147
Interactions View interactions

No strongly related genes found yet for CST9L.

No additional diseases found yet through genes similar to CST9L.