CST9 (cystatin 9)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 128822
• Gene name: Cystatin 9
• Gene symbol: CST9
• Synonyms (NCBI Gene): CLM, CTES7A
• Chromosome: 20
• Chromosome location: 20p11.21
• Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory

miRNA Show/Hide all (74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT487904	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT487903	hsa-miR-1207-3p	PAR-CLIP	23592263
MIRT487902	hsa-miR-7978	PAR-CLIP	23592263
MIRT487900	hsa-miR-138-5p	PAR-CLIP	23592263
MIRT487901	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487899	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487898	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487897	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487896	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT487895	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT487894	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT487892	hsa-miR-5698	PAR-CLIP	23592263
MIRT487893	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT487891	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT487890	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT487904	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT487903	hsa-miR-1207-3p	PAR-CLIP	23592263
MIRT487902	hsa-miR-7978	PAR-CLIP	23592263
MIRT487900	hsa-miR-138-5p	PAR-CLIP	23592263
MIRT487901	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487899	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487898	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487897	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487896	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT487895	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT487894	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT487892	hsa-miR-5698	PAR-CLIP	23592263
MIRT487893	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT487891	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT487890	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT913358	hsa-miR-1207-5p	CLIP-seq
MIRT913359	hsa-miR-1251	CLIP-seq
MIRT913360	hsa-miR-1305	CLIP-seq
MIRT913361	hsa-miR-1324	CLIP-seq
MIRT913362	hsa-miR-3154	CLIP-seq
MIRT913363	hsa-miR-3185	CLIP-seq
MIRT913364	hsa-miR-3714	CLIP-seq
MIRT913365	hsa-miR-421	CLIP-seq
MIRT913366	hsa-miR-4684-5p	CLIP-seq
MIRT913367	hsa-miR-4709-5p	CLIP-seq
MIRT913368	hsa-miR-4763-3p	CLIP-seq
MIRT913369	hsa-miR-4768-5p	CLIP-seq
MIRT913370	hsa-miR-4795-5p	CLIP-seq
MIRT913371	hsa-miR-518a-5p	CLIP-seq
MIRT913372	hsa-miR-527	CLIP-seq
MIRT913373	hsa-miR-646	CLIP-seq
MIRT913374	hsa-miR-940	CLIP-seq
MIRT1970864	hsa-miR-190	CLIP-seq
MIRT1970865	hsa-miR-190b	CLIP-seq
MIRT1970866	hsa-miR-3157-5p	CLIP-seq
MIRT1970867	hsa-miR-4252	CLIP-seq
MIRT1970868	hsa-miR-4691-3p	CLIP-seq
MIRT1970869	hsa-miR-505	CLIP-seq
MIRT2206643	hsa-miR-124	CLIP-seq
MIRT2206644	hsa-miR-1260	CLIP-seq
MIRT2206645	hsa-miR-1260b	CLIP-seq
MIRT2206646	hsa-miR-188-3p	CLIP-seq
MIRT2206647	hsa-miR-3156-3p	CLIP-seq
MIRT913364	hsa-miR-3714	CLIP-seq
MIRT2206648	hsa-miR-3910	CLIP-seq
MIRT2206649	hsa-miR-4301	CLIP-seq
MIRT2206650	hsa-miR-4446-5p	CLIP-seq
MIRT2206651	hsa-miR-4747-5p	CLIP-seq
MIRT2206652	hsa-miR-4755-3p	CLIP-seq
MIRT2206653	hsa-miR-506	CLIP-seq
MIRT2386546	hsa-miR-663b	CLIP-seq
MIRT2447735	hsa-miR-1225-3p	CLIP-seq
MIRT2447736	hsa-miR-3921	CLIP-seq
MIRT2447737	hsa-miR-4303	CLIP-seq
MIRT2447738	hsa-miR-4468	CLIP-seq
MIRT2447739	hsa-miR-4653-5p	CLIP-seq
MIRT2447740	hsa-miR-4749-3p	CLIP-seq
MIRT2447741	hsa-miR-4768-3p	CLIP-seq
MIRT2447741	hsa-miR-4768-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0019730	Process	Antimicrobial humoral response	IBA
GO:0019730	Process	Antimicrobial humoral response	IDA	23922243
GO:0030414	Function	Peptidase inhibitor activity	IEA

Other IDs

• MIM: 616543
• HGNC: 13261
• e!Ensembl: ENSG00000173335

Protein

• UniProt ID: Q5W186
• Protein name: Cystatin-9 (Cystatin-like molecule)
• Protein function: May be involved in testis development (By similarity). May play a role in hematopoietic differentiation or inflammation (PubMed:12535658). Has immunomodulatory and antimicrobial functions against Francisella tularensis, a Gram-negative bacteria
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00666	Cathelicidins	43 → 135		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, placenta, lung, liver, skeletal muscle and pancreas (PubMed:12535658). Not expressed in brain (PubMed:12535658). Expressed in epididymis, kidney, testis, spinal cord, and thymus with a strong expression in epididymi
• Sequence:

  MSSPQRRKAMPWALSLLLMGFQLLVTYAWCSEEEMGGNNKIVQDPMFLATVEFALNTFNV
  QSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLE
  LNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK

• Sequence length: 159

Related Genes

No strongly related genes found yet for CST9.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CST9.