CST5 (cystatin D)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1473
• Gene name: Cystatin D
• Gene symbol: CST5
• Synonyms (NCBI Gene): -
• Chromosome: 20
• Chromosome location: 20p11.21
• Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory

miRNA Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025131	hsa-miR-181a-5p	Microarray	17612493
MIRT913348	hsa-miR-1915	CLIP-seq
MIRT913349	hsa-miR-1976	CLIP-seq
MIRT913350	hsa-miR-3065-5p	CLIP-seq
MIRT913351	hsa-miR-3150b-3p	CLIP-seq
MIRT913352	hsa-miR-361-3p	CLIP-seq
MIRT913353	hsa-miR-370	CLIP-seq
MIRT913354	hsa-miR-4663	CLIP-seq
MIRT913355	hsa-miR-4689	CLIP-seq
MIRT913356	hsa-miR-4784	CLIP-seq
MIRT913357	hsa-miR-769-5p	CLIP-seq
MIRT913349	hsa-miR-1976	CLIP-seq
MIRT913350	hsa-miR-3065-5p	CLIP-seq
MIRT913353	hsa-miR-370	CLIP-seq
MIRT913354	hsa-miR-4663	CLIP-seq
MIRT913348	hsa-miR-1915	CLIP-seq
MIRT913352	hsa-miR-361-3p	CLIP-seq
MIRT2206633	hsa-miR-4300	CLIP-seq
MIRT2206634	hsa-miR-4447	CLIP-seq
MIRT2206635	hsa-miR-4472	CLIP-seq
MIRT2206636	hsa-miR-4488	CLIP-seq
MIRT2206637	hsa-miR-455-3p	CLIP-seq
MIRT2206638	hsa-miR-4651	CLIP-seq
MIRT2206639	hsa-miR-4685-5p	CLIP-seq
MIRT2206640	hsa-miR-4697-5p	CLIP-seq
MIRT2206641	hsa-miR-608	CLIP-seq
MIRT2206642	hsa-miR-920	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
VDR	Activation	19662683

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IBA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IDA	8083219
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	TAS	1939105
GO:0005515	Function	Protein binding	IPI	8083219
GO:0005576	Component	Extracellular region	IDA	8083219
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031982	Component	Vesicle	IBA
GO:0070062	Component	Extracellular exosome	HDA	19199708

Other IDs

• MIM: 123858
• HGNC: 2477
• e!Ensembl: ENSG00000170367

Protein

• UniProt ID: P28325
• Protein name: Cystatin-D (Cystatin-5)
• Protein function: Cysteine proteinase inhibitor that possibly plays a protective role against proteinases present in the oral cavity. The order of preference for inhibition is cathepsin S > cathepsin H > cathepsin L > cathepsin B.
• PDB: 1RN7 , 1ROA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00031	Cystatin	32 → 128	Cystatin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in parotid gland but not in seminal vesicle, prostate, epididymis, testis, ovary, placenta, thyroid, gastric corpus, small intesti
• Sequence:

  MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVIN
  KDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCS
  FQINEVPWEDKISILNYKCRKV

• Sequence length: 142

Pathways

KEGG Pathway:

Salivary secretion

Related Genes

No strongly related genes found yet for CST5.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CST5.