CST11 (cystatin 11)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 140880
• Gene name: Cystatin 11
• Gene symbol: CST11
• Synonyms (NCBI Gene): CST8L, CTES2, SC13, dJ322G13.6
• Chromosome: 20
• Chromosome location: 20p11.21
• Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IMP	12072414
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IMP	12072414
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0030521	Process	Androgen receptor signaling pathway	ISS	12072414
GO:0031640	Process	Killing of cells of another organism	IDA	12072414
GO:0036126	Component	Sperm flagellum	IBA
GO:0036126	Component	Sperm flagellum	IDA	12072414
GO:0042742	Process	Defense response to bacterium	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	12072414
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0061827	Component	Sperm head	IBA
GO:0061827	Component	Sperm head	IDA	12072414

Other IDs

• MIM: 609731
• HGNC: 15959
• e!Ensembl: ENSG00000125831

Protein

• UniProt ID: Q9H112
• Protein name: Cystatin-11
• Protein function: Has antibacterial activity against the Gram-negative bacteria E.coli. May play a role in sperm maturation and fertilization.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00031	Cystatin	33 → 124	Cystatin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in the epithelium and lumen of the epididymis, and in sperm (at protein level). {ECO:0000269|PubMed:12072414}.
• Sequence:

  MMAEPWQALQLLLAILLTLMALPYQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESD
  DKYHFRIFRVLKVQRQVTDHLEYHLNVEMQWTTCQKPETTNCVPQERELHKQVNCFFSVF
  AVPWFEQYKILNKSCSSD

• Sequence length: 138

Related Genes

No strongly related genes found yet for CST11.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CST11.