CSPG4 (chondroitin sulfate proteoglycan 4)

Gene

• Entrez ID: 1464
• Gene name: Chondroitin sulfate proteoglycan 4
• Gene symbol: CSPG4
• Synonyms (NCBI Gene): CSPG4A, HMW-MAA, MCSP, MCSPG, MEL-CSPG, MSK16, NG2
• Chromosome: 15
• Chromosome location: 15q24.2
• Summary: A human melanoma-associated chondroitin sulfate proteoglycan plays a role in stabilizing cell-substratum interactions during early events of melanoma cell spreading on endothelial basement membranes. CSPG4 represents an integral membrane chondroitin sulfa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022345	hsa-miR-124-3p	Microarray	18668037
MIRT912897	hsa-miR-1237	CLIP-seq
MIRT912898	hsa-miR-1248	CLIP-seq
MIRT912899	hsa-miR-1285	CLIP-seq
MIRT912900	hsa-miR-1915	CLIP-seq
MIRT912901	hsa-miR-1972	CLIP-seq
MIRT912902	hsa-miR-296-5p	CLIP-seq
MIRT912903	hsa-miR-3157-3p	CLIP-seq
MIRT912904	hsa-miR-3187-5p	CLIP-seq
MIRT912905	hsa-miR-378g	CLIP-seq
MIRT912906	hsa-miR-4252	CLIP-seq
MIRT912907	hsa-miR-4279	CLIP-seq
MIRT912908	hsa-miR-4310	CLIP-seq
MIRT912909	hsa-miR-4486	CLIP-seq
MIRT912910	hsa-miR-490-3p	CLIP-seq
MIRT912911	hsa-miR-502-5p	CLIP-seq
MIRT912912	hsa-miR-612	CLIP-seq
MIRT912913	hsa-miR-642b	CLIP-seq
MIRT912914	hsa-miR-649	CLIP-seq
MIRT912915	hsa-miR-874	CLIP-seq
MIRT1970749	hsa-miR-1912	CLIP-seq
MIRT1970750	hsa-miR-331-3p	CLIP-seq
MIRT1970751	hsa-miR-4292	CLIP-seq
MIRT1970752	hsa-miR-4308	CLIP-seq
MIRT1970753	hsa-miR-4447	CLIP-seq
MIRT1970754	hsa-miR-4459	CLIP-seq
MIRT1970755	hsa-miR-4472	CLIP-seq
MIRT1970756	hsa-miR-4488	CLIP-seq
MIRT1970757	hsa-miR-4697-5p	CLIP-seq
MIRT1970758	hsa-miR-711	CLIP-seq
MIRT2206525	hsa-miR-1910	CLIP-seq
MIRT912900	hsa-miR-1915	CLIP-seq
MIRT2206526	hsa-miR-361-3p	CLIP-seq
MIRT2206527	hsa-miR-4283	CLIP-seq
MIRT1970751	hsa-miR-4292	CLIP-seq
MIRT1970752	hsa-miR-4308	CLIP-seq
MIRT2206528	hsa-miR-455-3p	CLIP-seq
MIRT2678719	hsa-miR-198	CLIP-seq
MIRT2678720	hsa-miR-3591-3p	CLIP-seq
MIRT2678721	hsa-miR-520a-5p	CLIP-seq
MIRT2678722	hsa-miR-525-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001726	Component	Ruffle	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8790396
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006929	Process	Substrate-dependent cell migration	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0008347	Process	Glial cell migration	IEA
GO:0009986	Component	Cell surface	HDA	19581412
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	TAS	10587647
GO:0015026	Function	Coreceptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	10587647
GO:0030154	Process	Cell differentiation	IEA
GO:0031012	Component	Extracellular matrix	HDA	27068509, 28675934
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0035556	Process	Intracellular signal transduction	IDA	10587647
GO:0042995	Component	Cell projection	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048771	Process	Tissue remodeling	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	10587647
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0097178	Process	Ruffle assembly	IEA

Other IDs

• MIM: 601172
• HGNC: 2466
• e!Ensembl: ENSG00000173546

Protein

• UniProt ID: Q6UVK1
• Protein name: Chondroitin sulfate proteoglycan 4 (Chondroitin sulfate proteoglycan NG2) (Melanoma chondroitin sulfate proteoglycan) (Melanoma-associated chondroitin sulfate proteoglycan)
• Protein function: Proteoglycan playing a role in cell proliferation and migration which stimulates endothelial cells motility during microvascular morphogenesis. May also inhibit neurite outgrowth and growth cone collapse during axon regeneration. Cell surface re
• PDB: 7ML7, 7N8X, 7N9Y
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02210	Laminin_G_2	55 → 178	Laminin G domain	Domain
  PF02210	Laminin_G_2	230 → 363	Laminin G domain	Domain
  PF16184	Cadherin_3	423 → 524		Domain
  PF16184	Cadherin_3	536 → 645		Domain
  PF16184	Cadherin_3	652 → 766		Domain
  PF16184	Cadherin_3	771 → 879		Domain
  PF16184	Cadherin_3	884 → 990		Domain
  PF16184	Cadherin_3	1001 → 1110		Domain
  PF16184	Cadherin_3	1115 → 1218		Domain
  PF16184	Cadherin_3	1221 → 1339		Domain
  PF16184	Cadherin_3	1358 → 1450		Domain
  PF16184	Cadherin_3	1456 → 1563		Domain
  PF16184	Cadherin_3	1572 → 1679		Domain
  PF16184	Cadherin_3	1690 → 1803		Domain
  PF16184	Cadherin_3	1815 → 1924		Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in fibroblasts (at protein level) (PubMed:36213313). Detected in placenta (at protein level) (PubMed:32337544). Detected in malignant melanoma cells. {ECO:0000269|PubMed:32337544, ECO:0000269|PubMed:36213313, ECO:0000269|PubMe
• Sequence:

  MQSGPRPPLPAPGLALALTLTMLARLASAASFFGENHLEVPVATALTDIDLQLQFSTSQP
  EALLLLAAGPADHLLLQLYSGRLQVRLVLGQEELRLQTPAETLLSDSIPHTVVLTVVEGW
  ATLSVDGFLNASSAVPGAPLEVPYGLFVGGTGTLGLPYLRGTSRPLRGCLHAATLNGRSL
  LRPLTPDVHEGCAEEFSASDDVALGFSGPHSLAAFPAWGTQDEGTLEFTLTTQSRQAPLA
  FQAGGRRGDFIYVDIFEGHLRAVVEKGQGTVLLHNSVPVADGQPHEVSVHINAHRLEISV
  DQYPTHTSNRGVLSYLEPRGSLLLGGLDAEASRHLQEHRLGLTPEATNASLLGCMEDLSV
  NGQRRGLREALLTRNMAAGCRLEEEEYEDDAYGHYEAFSTLAPEAWPAMELPEPCVPEPG
  LPPVFANFTQLLTISPLVVAEGGTAWLEWRHVQPTLDLMEAELRKSQVLFSVTRGARHGE
  LELDIPGAQARKMFTLLDVVNRKARFIHDGSEDTSDQLVLEVSVTARVPMPSCLRRGQTY
  LLPIQVNPVNDPPHIIFPHGSLMVILEHTQKPLGPEVFQAYDPDSACEGLTFQVLGTSSG
  LPVERRDQPGEPATEFSCRELEAGSLVYVHRGGPAQDLTFRVSDGLQASPPATLKVVAIR
  PAIQIHRSTGLRLAQGSAMPILPANLSVETNAVGQDVSVLFRVTGALQFGELQKQGAGGV
  EGAEWWATQAFHQRDVEQGRVRYLSTDPQHHAYDTVENLALEVQVGQEILSNLSFPVTIQ
  RATVWMLRLEPLHTQNTQQETLTTAHLEATLEEAGPSPPTFHYEVVQAPRKGNLQLQGTR
  LSDGQGFTQDDIQAGRVTYGATARASEAVEDTFRFRVTAPPYFSPLYTFPIHIGGDPDAP
  VLTNVLLVVPEGGEGVLSADHLFVKSLNSASYLYEVMERPRHGRLAWRGTQDKTTMVTSF
  TNEDLLRGRLVYQHDDSETTEDDIPFVATRQGESSGDMAWEEVRGVFRVAIQPVNDHAPV
  QTISRIFHVARGGRRLLTTDDVAFSDADSGFADAQLVLTRKDLLFGSIVAVDEPTRPIYR
  FTQEDLRKRRVLFVHSGADRGWIQLQVSDGQHQATALLEVQASEPYLRVANGSSLVVPQG
  GQGTIDTAVLHLDTNLDIRSGDEVHYHVTAGPRWGQLVRAGQPATAFSQQDLLDGAVLYS
  HNGSLSPRDTMAFSVEAGPVHTDATLQVTIALEGPLAPLKLVRHKKIYVFQGEAAEIRRD
  QLEAAQEAVPPADIVFSVKSPPSAGYLVMVSRGALADEPPSLDPVQSFSQEAVDTGRVLY
  LHSRPEAWSDAFSLDVASGLGAPLEGVLVELEVLPAAIPLEAQNFSVPEGGSLTLAPPLL
  RVSGPYFPTLLGLSLQVLEPPQHGALQKEDGPQARTLSAFSWRMVEEQLIRYVHDGSETL
  TDSFVLMANASEMDRQSHPVAFTVTVLPVNDQPPILTTNTGLQMWEGATAPIPAEALRST
  DGDSGSEDLVYTIEQPSNGRVVLRGAPGTEVRSFTQAQLDGGLVLFSHRGTLDGGFRFRL
  SDGEHTSPGHFFRVTAQKQVLLSLKGSQTLTVCPGSVQPLSSQTLRASSSAGTDPQLLLY
  RVVRGPQLGRLFHAQQDSTGEALVNFTQAEVYAGNILYEHEMPPEPFWEAHDTLELQLSS
  PPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSP
  QRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHF
  RAHLQGPAGASVAGPQTSEAFAITVRDVNERPPQPQASVPLRLTRGSRAPISRAQLSVVD
  PDSAPGEIEYEVQRAPHNGFLSLVGGGLGPVTRFTQADVDSGRLAFVANGSSVAGIFQLS
  MSDGASPPLPMSLAVDILPSAIEVQLRAPLEVPQALGRSSLSQQQLRVVSDREEPEAAYR
  LIQGPQYGHLLVGGRPTSAFSQFQIDQGEVVFAFTNFSSSHDHFRVLALARGVNASAVVN
  VTVRALLHVWAGGPWPQGATLRLDPTVLDAGELANRTGSVPRFRLLEGPRHGRVVRVPRA
  RTEPGGSQLVEQFTQQDLEDGRLGLEVGRPEGRAPGPAGDSLTLELWAQGVPPAVASLDF
  ATEPYNAARPYSVALLSVPEAARTEAGKPESSTPTGEPGPMASSPEPAVAKGGFLSFLEA
  NMFSVIIPMCLVLLLLALILPLLFYLRKRNKTGKHDVQVLTAKPRNGLAGDTETFRKVEP
  GQAIPLTAVPGQGPPPGGQPDPELLQFCRTPNPALKNGQYWV

• Sequence length: 2322

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS, RELAPSING-REMITTING	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GenCC Disgenet, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	36012380	Inhibit	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10468613, 28945172, 32599896	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29036679		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29540359, 31230410		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21658254, 27037627, 29375561, 30625226		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22984505, 24177010, 34993493	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22732936	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26074703	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34318902	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	18641983, 27292772	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	27292772		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	18641983, 26689475	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	26689475		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31195686		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31257292		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31195686, 8790396		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28764769		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	30367354	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31692559		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30086518		★☆☆☆☆ Found in Text Mining only
Elejalde Disease	Hereditary elliptocytosis	Pubtator	16309171	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28098860		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10468613, 21863242, 28643756, 28945172, 32599896, 37849763	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21829586, 21863242, 28945172, 29491184, 29540359, 30213051, 30625226		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21829586, 21863242, 28945172, 29491184, 29540359, 30625226		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23804106, 28643756, 32599896, 34318902, 36292695	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29540359		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25935541	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24932730	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36012380	Inhibit	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	29196603		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37858084	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	39682704	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25706398, 31195686, 38037221	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31195686		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25706398	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26074703		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37849763	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20805128	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26074703	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21658254, 27037627, 29375561, 30625226		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28098860		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21070915, 21829586, 22021902, 24932730, 28098860, 28668095, 28981720, 30213051, 31128201, 31217827		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10197164, 10400790, 18337643, 18519770, 19233913, 20395199, 20805128, 21595914, 21660451, 2203468, 22281663, 24177010, 25574741, 26815318, 27879288, 27926479, 28852061, 2916650, 31140988, 33649790, 34318902, 37849763, 37901209	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15210734, 15951843, 19738072, 20309546, 21092273, 21717063, 21829586, 22021902, 24258997, 25997619, 29375561, 29565434, 30769764, 30916367, 31128201, 31140988, 31195686, 31661001, 31779130, 8790396		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15210734, 18519770		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20448346	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	20805128	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31195686	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30086518		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29375561		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	27879288		★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	29268706	Associate	★☆☆☆☆ Found in Text Mining only
Muscular dystrophy congenital, merosin negative	Congenital Muscular Dystrophy	BEFREE	12812755		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16407841, 17548607, 19738072, 21070915, 21829586, 23097628, 23559515, 24740185, 24932730, 25997619, 26074703, 26689475, 27037627, 28098860, 28668095, 29196603, 29491184, 29561763, 29565434, 30916367		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	29491184		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21660451	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	34344877	Associate	★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	10468613, 24278309, 32599896	Associate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	29308320, 30213051		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19546472	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31217827		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	24932730		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24932730	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	18767415		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31692559		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18634019		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	18634019, 36221119	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29196603		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29302076, 31455859		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31217827		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25935541, 38422829	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24740185		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	29196603		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37854594	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25667103, 27037627, 29561763, 29565434		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34318902, 37432459	Associate	★☆☆☆☆ Found in Text Mining only
Ullrich congenital muscular dystrophy 1	Ullrich Congenital Muscular Dystrophy	BEFREE	16169245		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35462469, 38015710, 40615671	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	12714409	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	29308320, 30213051		★☆☆☆☆ Found in Text Mining only