Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1464
Gene name	Chondroitin sulfate proteoglycan 4
Gene symbol	CSPG4
Synonyms (NCBI Gene)	CSPG4AHMW-MAAMCSPMCSPGMEL-CSPGMSK16NG2
Chromosome	15
Chromosome location	15q24.2
Summary	A human melanoma-associated chondroitin sulfate proteoglycan plays a role in stabilizing cell-substratum interactions during early events of melanoma cell spreading on endothelial basement membranes. CSPG4 represents an integral membrane chondroitin sulfa

41 Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022345	hsa-miR-124-3p	Microarray	18668037
MIRT912897	hsa-miR-1237	CLIP-seq
MIRT912898	hsa-miR-1248	CLIP-seq
MIRT912899	hsa-miR-1285	CLIP-seq
MIRT912900	hsa-miR-1915	CLIP-seq
MIRT912901	hsa-miR-1972	CLIP-seq
MIRT912902	hsa-miR-296-5p	CLIP-seq
MIRT912903	hsa-miR-3157-3p	CLIP-seq
MIRT912904	hsa-miR-3187-5p	CLIP-seq
MIRT912905	hsa-miR-378g	CLIP-seq
MIRT912906	hsa-miR-4252	CLIP-seq
MIRT912907	hsa-miR-4279	CLIP-seq
MIRT912908	hsa-miR-4310	CLIP-seq
MIRT912909	hsa-miR-4486	CLIP-seq
MIRT912910	hsa-miR-490-3p	CLIP-seq
MIRT912911	hsa-miR-502-5p	CLIP-seq
MIRT912912	hsa-miR-612	CLIP-seq
MIRT912913	hsa-miR-642b	CLIP-seq
MIRT912914	hsa-miR-649	CLIP-seq
MIRT912915	hsa-miR-874	CLIP-seq
MIRT1970749	hsa-miR-1912	CLIP-seq
MIRT1970750	hsa-miR-331-3p	CLIP-seq
MIRT1970751	hsa-miR-4292	CLIP-seq
MIRT1970752	hsa-miR-4308	CLIP-seq
MIRT1970753	hsa-miR-4447	CLIP-seq
MIRT1970754	hsa-miR-4459	CLIP-seq
MIRT1970755	hsa-miR-4472	CLIP-seq
MIRT1970756	hsa-miR-4488	CLIP-seq
MIRT1970757	hsa-miR-4697-5p	CLIP-seq
MIRT1970758	hsa-miR-711	CLIP-seq
MIRT2206525	hsa-miR-1910	CLIP-seq
MIRT912900	hsa-miR-1915	CLIP-seq
MIRT2206526	hsa-miR-361-3p	CLIP-seq
MIRT2206527	hsa-miR-4283	CLIP-seq
MIRT1970751	hsa-miR-4292	CLIP-seq
MIRT1970752	hsa-miR-4308	CLIP-seq
MIRT2206528	hsa-miR-455-3p	CLIP-seq
MIRT2678719	hsa-miR-198	CLIP-seq
MIRT2678720	hsa-miR-3591-3p	CLIP-seq
MIRT2678721	hsa-miR-520a-5p	CLIP-seq
MIRT2678722	hsa-miR-525-5p	CLIP-seq

31 Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001726	Component	Ruffle	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8790396
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006929	Process	Substrate-dependent cell migration	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0008347	Process	Glial cell migration	IEA
GO:0009986	Component	Cell surface	HDA	19581412
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	TAS	10587647
GO:0015026	Function	Coreceptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	10587647
GO:0030154	Process	Cell differentiation	IEA
GO:0031012	Component	Extracellular matrix	HDA	27068509, 28675934
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0035556	Process	Intracellular signal transduction	IDA	10587647
GO:0042995	Component	Cell projection	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048771	Process	Tissue remodeling	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	10587647
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0097178	Process	Ruffle assembly	IEA

MIM	HGNC	e!Ensembl
601172	2466	ENSG00000173546

Q6UVK1

Protein name

Chondroitin sulfate proteoglycan 4 (Chondroitin sulfate proteoglycan NG2) (Melanoma chondroitin sulfate proteoglycan) (Melanoma-associated chondroitin sulfate proteoglycan)

Protein function

Proteoglycan playing a role in cell proliferation and migration which stimulates endothelial cells motility during microvascular morphogenesis. May also inhibit neurite outgrowth and growth cone collapse during axon regeneration. Cell surface re

PDB

7ML7 , 7N8X , 7N9Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02210	Laminin_G_2	230 → 363	Laminin G domain	Domain
PF02210	Laminin_G_2	55 → 178	Laminin G domain	Domain
PF16184	Cadherin_3	1456 → 1563		Domain
PF16184	Cadherin_3	1815 → 1924		Domain
PF16184	Cadherin_3	536 → 645		Domain
PF16184	Cadherin_3	1001 → 1110		Domain
PF16184	Cadherin_3	1221 → 1339		Domain
PF16184	Cadherin_3	884 → 990		Domain
PF16184	Cadherin_3	1690 → 1803		Domain
PF16184	Cadherin_3	771 → 879		Domain
PF16184	Cadherin_3	1115 → 1218		Domain
PF16184	Cadherin_3	1572 → 1679		Domain
PF16184	Cadherin_3	423 → 524		Domain
PF16184	Cadherin_3	1358 → 1450		Domain
PF16184	Cadherin_3	652 → 766		Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in fibroblasts (at protein level) (PubMed:36213313). Detected in placenta (at protein level) (PubMed:32337544). Detected in malignant melanoma cells. {ECO:0000269|PubMed:32337544, ECO:0000269|PubMed:36213313, ECO:0000269|PubMe

Sequence

MQSGPRPPLPAPGLALALTLTMLARLASAASFFGENHLEVPVATALTDIDLQLQFSTSQP
EALLLLAAGPADHLLLQLYSGRLQVRLVLGQEELRLQTPAETLLSDSIPHTVVLTVVEGW
ATLSVDGFLNASSAVPGAPLEVPYGLFVGGTGTLGLPYLRGTSRPLRGCLHAATLNGRSL
LRPLTPDVHEGCAEEFSASDDVALGFSGPHSLAAFPAWGTQDEGTLEFTLTTQSRQAPLA
FQAGGRRGDFIYVDIFEGHLRAVVEKGQGTVLLHNSVPVADGQPHEVSVHINAHRLEISV
DQYPTHTSNRGVLSYLEPRGSLLLGGLDAEASRHLQEHRLGLTPEATNASLLGCMEDLSV
NGQRRGLREALLTRNMAAGCRLEEEEYEDDAYGHYEAFSTLAPEAWPAMELPEPCVPEPG
LPPVFANFTQLLTISPLVVAEGGTAWLEWRHVQPTLDLMEAELRKSQVLFSVTRGARHGE
LELDIPGAQARKMFTLLDVVNRKARFIHDGSEDTSDQLVLEVSVTARVPMPSCLRRGQTY
LLPIQVNPVNDPPHIIFPHGSLMVILEHTQKPLGPEVFQAYDPDSACEGLTFQVLGTSSG
LPVERRDQPGEPATEFSCRELEAGSLVYVHRGGPAQDLTFRVSDGLQASPPATLKVVAIR
PAIQIHRSTGLRLAQGSAMPILPANLSVETNAVGQDVSVLFRVTGALQFGELQKQGAGGV
EGAEWWATQAFHQRDVEQGRVRYLSTDPQHHAYDTVENLALEVQVGQEILSNLSFPVTIQ
RATVWMLRLEPLHTQNTQQETLTTAHLEATLEEAGPSPPTFHYEVVQAPRKGNLQLQGTR
LSDGQGFTQDDIQAGRVTYGATARASEAVEDTFRFRVTAPPYFSPLYTFPIHIGGDPDAP
VLTNVLLVVPEGGEGVLSADHLFVKSLNSASYLYEVMERPRHGRLAWRGTQDKTTMVTSF
TNEDLLRGRLVYQHDDSETTEDDIPFVATRQGESSGDMAWEEVRGVFRVAIQPVNDHAPV
QTISRIFHVARGGRRLLTTDDVAFSDADSGFADAQLVLTRKDLLFGSIVAVDEPTRPIYR
FTQEDLRKRRVLFVHSGADRGWIQLQVSDGQHQATALLEVQASEPYLRVANGSSLVVPQG
GQGTIDTAVLHLDTNLDIRSGDEVHYHVTAGPRWGQLVRAGQPATAFSQQDLLDGAVLYS
HNGSLSPRDTMAFSVEAGPVHTDATLQVTIALEGPLAPLKLVRHKKIYVFQGEAAEIRRD
QLEAAQEAVPPADIVFSVKSPPSAGYLVMVSRGALADEPPSLDPVQSFSQEAVDTGRVLY
LHSRPEAWSDAFSLDVASGLGAPLEGVLVELEVLPAAIPLEAQNFSVPEGGSLTLAPPLL
RVSGPYFPTLLGLSLQVLEPPQHGALQKEDGPQARTLSAFSWRMVEEQLIRYVHDGSETL
TDSFVLMANASEMDRQSHPVAFTVTVLPVNDQPPILTTNTGLQMWEGATAPIPAEALRST
DGDSGSEDLVYTIEQPSNGRVVLRGAPGTEVRSFTQAQLDGGLVLFSHRGTLDGGFRFRL
SDGEHTSPGHFFRVTAQKQVLLSLKGSQTLTVCPGSVQPLSSQTLRASSSAGTDPQLLLY
RVVRGPQLGRLFHAQQDSTGEALVNFTQAEVYAGNILYEHEMPPEPFWEAHDTLELQLSS
PPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSP
QRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHF
RAHLQGPAGASVAGPQTSEAFAITVRDVNERPPQPQASVPLRLTRGSRAPISRAQLSVVD
PDSAPGEIEYEVQRAPHNGFLSLVGGGLGPVTRFTQADVDSGRLAFVANGSSVAGIFQLS
MSDGASPPLPMSLAVDILPSAIEVQLRAPLEVPQALGRSSLSQQQLRVVSDREEPEAAYR
LIQGPQYGHLLVGGRPTSAFSQFQIDQGEVVFAFTNFSSSHDHFRVLALARGVNASAVVN
VTVRALLHVWAGGPWPQGATLRLDPTVLDAGELANRTGSVPRFRLLEGPRHGRVVRVPRA
RTEPGGSQLVEQFTQQDLEDGRLGLEVGRPEGRAPGPAGDSLTLELWAQGVPPAVASLDF
ATEPYNAARPYSVALLSVPEAARTEAGKPESSTPTGEPGPMASSPEPAVAKGGFLSFLEA
NMFSVIIPMCLVLLLLALILPLLFYLRKRNKTGKHDVQVLTAKPRNGLAGDTETFRKVEP
GQAIPLTAVPGQGPPPGGQPDPELLQFCRTPNPALKNGQYWV

Sequence length

2322

Interactions

View interactions

Reactome Pathway
A tetrasaccharide linker sequence is required for GAG synthesis
Chondroitin sulfate biosynthesis
Dermatan sulfate biosynthesis
CS/DS degradation
Defective B4GALT7 causes EDS, progeroid type
Defective B3GAT3 causes JDSSDHD
Defective CHST3 causes SEDCJD
Defective CHST14 causes EDS, musculocontractural type
Defective CHSY1 causes TPBS
Defective B3GALT6 causes EDSP2 and SEMDJL1

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
CARCINOMA, BASAL CELL	—	CTD	36428691	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	28284560	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33462484	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS, RELAPSING-REMITTING	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	GWAS catalog	31220337	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GenCC Disgenet, GenCC	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (84)
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	36012380	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10468613, 28945172, 32599896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29036679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29540359, 31230410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21658254, 27037627, 29375561, 30625226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22984505, 24177010, 34993493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22732936	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26074703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34318902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CSPG5	[]	10	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS"]	0	[]
NCAN	[]	10	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS"]	0	[]
BGN	[]	10	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS"]	0	[]
BCAN	[]	10	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS"]	0	[]
VCAN	[]	10	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS"]	1	["CTD (Basal cell carcinoma)"]

CSPG4 (chondroitin sulfate proteoglycan 4)

Bookmark This Gene