CSNK2A2 (casein kinase 2 alpha 2)

Gene

• Entrez ID: 1459
• Gene name: Casein kinase 2 alpha 2
• Gene symbol: CSNK2A2
• Synonyms (NCBI Gene): CK2A2, CK2alpha', CSNK2A1
• Chromosome: 16
• Chromosome location: 16q21
• Summary: This gene encodes the alpha`, or alpha 2, catalytic subunit of the protein kinase enzyme, casein kinase 2 (CK2). Casein kinase 2 is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular pr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024100	hsa-miR-1-3p	Proteomics	18668040
MIRT053052	hsa-miR-1228-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23554909
MIRT053052	hsa-miR-1228-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23554909
MIRT912875	hsa-miR-1289	CLIP-seq
MIRT912876	hsa-miR-3185	CLIP-seq
MIRT912877	hsa-miR-3198	CLIP-seq
MIRT912878	hsa-miR-421	CLIP-seq
MIRT912879	hsa-miR-4294	CLIP-seq
MIRT912880	hsa-miR-4309	CLIP-seq
MIRT912881	hsa-miR-4318	CLIP-seq
MIRT912882	hsa-miR-4709-5p	CLIP-seq
MIRT912883	hsa-miR-4786-3p	CLIP-seq
MIRT912884	hsa-miR-505	CLIP-seq
MIRT912885	hsa-miR-671-5p	CLIP-seq
MIRT2206520	hsa-miR-3160-5p	CLIP-seq
MIRT2206521	hsa-miR-4314	CLIP-seq
MIRT2206522	hsa-miR-544	CLIP-seq
MIRT2509773	hsa-miR-1178	CLIP-seq
MIRT2509774	hsa-miR-1284	CLIP-seq
MIRT2509775	hsa-miR-208a	CLIP-seq
MIRT2509776	hsa-miR-208b	CLIP-seq
MIRT2509777	hsa-miR-2113	CLIP-seq
MIRT2509778	hsa-miR-3148	CLIP-seq
MIRT2509779	hsa-miR-346	CLIP-seq
MIRT2509780	hsa-miR-3688-3p	CLIP-seq
MIRT2509781	hsa-miR-4273	CLIP-seq
MIRT2509782	hsa-miR-4288	CLIP-seq
MIRT2509783	hsa-miR-4677-5p	CLIP-seq
MIRT2509784	hsa-miR-4695-3p	CLIP-seq
MIRT2509785	hsa-miR-4711-3p	CLIP-seq
MIRT2509786	hsa-miR-4715-3p	CLIP-seq
MIRT2509787	hsa-miR-499-5p	CLIP-seq
MIRT2509788	hsa-miR-578	CLIP-seq
MIRT2509789	hsa-miR-592	CLIP-seq
MIRT2509790	hsa-miR-599	CLIP-seq
MIRT2509791	hsa-miR-632	CLIP-seq
MIRT2509792	hsa-miR-659	CLIP-seq
MIRT2509793	hsa-miR-767-3p	CLIP-seq
MIRT2509773	hsa-miR-1178	CLIP-seq
MIRT2509774	hsa-miR-1284	CLIP-seq
MIRT2509775	hsa-miR-208a	CLIP-seq
MIRT2509776	hsa-miR-208b	CLIP-seq
MIRT2509777	hsa-miR-2113	CLIP-seq
MIRT2509778	hsa-miR-3148	CLIP-seq
MIRT2509779	hsa-miR-346	CLIP-seq
MIRT2509780	hsa-miR-3688-3p	CLIP-seq
MIRT2509781	hsa-miR-4273	CLIP-seq
MIRT2509782	hsa-miR-4288	CLIP-seq
MIRT2509783	hsa-miR-4677-5p	CLIP-seq
MIRT2509784	hsa-miR-4695-3p	CLIP-seq
MIRT2509785	hsa-miR-4711-3p	CLIP-seq
MIRT2509786	hsa-miR-4715-3p	CLIP-seq
MIRT2678716	hsa-miR-4796-3p	CLIP-seq
MIRT2509787	hsa-miR-499-5p	CLIP-seq
MIRT2678717	hsa-miR-548t	CLIP-seq
MIRT2509788	hsa-miR-578	CLIP-seq
MIRT2678718	hsa-miR-589	CLIP-seq
MIRT2509789	hsa-miR-592	CLIP-seq
MIRT2509790	hsa-miR-599	CLIP-seq
MIRT2509791	hsa-miR-632	CLIP-seq
MIRT2509792	hsa-miR-659	CLIP-seq
MIRT2509793	hsa-miR-767-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000785	Component	Chromatin	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	20545769, 21482717, 22325354, 30898438, 35597237
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IGI	28031292
GO:0005515	Function	Protein binding	IPI	10094392, 11972058, 14667819, 19011756, 21988832, 23455922, 23555304, 25416956, 25519132, 25852190, 26496610, 27705803, 28031292, 28514442, 31515488, 32296183, 32707033, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21282530
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005956	Component	Protein kinase CK2 complex	IBA
GO:0005956	Component	Protein kinase CK2 complex	ISS
GO:0006302	Process	Double-strand break repair	IDA	22325354
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0031519	Component	PcG protein complex	IDA	21282530
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IGI	28031292
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0097421	Process	Liver regeneration	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1901524	Process	Regulation of mitophagy	HMP	24912190
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24912190
GO:1905818	Process	Regulation of chromosome separation	IBA
GO:1905818	Process	Regulation of chromosome separation	IMP	11704824
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	TAS	28031292

Other IDs

• MIM: 115442
• HGNC: 2459
• e!Ensembl: ENSG00000070770

Protein

• UniProt ID: P19784
• Protein name: Casein kinase II subunit alpha' (CK II alpha') (EC 2.7.11.1)
• Protein function: Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine (PubMed:11239457, PubMed:117048
• PDB: 3E3B, 3OFM, 3U87, 5M4U, 5M56, 5OOI, 5Y9M, 5YF9, 5YWM, 6HMB, 6HMC, 6HMD, 6HMQ, 6L20, 6QY8, 6QY9, 6TE2, 6TEW, 6TGU, 7A1B, 7A1Z, 7A22, 7A2H, 7AT9, 7ATV, 7XYH, 8Q77, 8Q9S, 8QBU, 8QCD, 8QCG, 8QF1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	40 → 325	Protein kinase domain	Domain

• Sequence:

  MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
  TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
  DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
  EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNY
  DQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
  LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

• Sequence length: 350

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BLOOD COAGULATION DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CSNK2A2-related disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	11423974, 11827167		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	LHGDN	11972058		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	26437031		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28558704	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	BEFREE	23153582		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	29439675	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25880754	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35607269	Stimulate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25241897		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11423974, 23768371, 27306791, 27746184		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24098452, 26703694, 27746184, 33164285, 37348024	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	25788269	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24616922, 27746184, 31406250	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	25227853	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	33164285	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24616922	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	25227853	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	24831064		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20625391, 30250529		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26637171, 28355289	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	38290659	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27906674	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28975890	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	40179422	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30883733		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	26499333		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31116803		★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19855935, 23137536		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20610541		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19098285, 19855935, 21359197, 21702981, 32737302, 36333388	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26876164		★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Familial	Creutzfeldt-Jakob disease	BEFREE	18404245		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	29383814		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	40317201	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32296102	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	34418601	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29223351		★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	17954558, 21761202, 24395637, 27048600, 28135719, 29240241		★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	27048600, 28585349		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	33421986	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30883733		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22675025	Associate	★☆☆☆☆ Found in Text Mining only
Fatal Familial Insomnia	Fatal Insomnia	BEFREE	18404245		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24036851, 25241897		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24036851, 25241897		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	30655572		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28335614		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27306791		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24098452, 25541719	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	30655572		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	40317201	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37047552	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29772186		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24283803, 33592500	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24616922		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22768056, 23651443, 31668570, 36142846	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25227853	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33164285	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23153582, 29772186		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28335614		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11423974, 23768371, 27306791		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20625391, 30250529		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20718998		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11069898, 15634760, 16222144		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	18572023		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31819646		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15634760, 16222144, 16687488, 24831064, 27306791, 28335614, 29772186		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19855935, 23137536		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16357145		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17629615		★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	24994558		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	29188362		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	31406250	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24825855		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27226552, 27251789	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	25422081	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25422081	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34418601	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	39915227	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	20718998	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15634760, 16222144, 17847034, 20371694, 23768371, 28335614, 28840260, 29772186		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27164076, 27251789	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28585349, 30655572, 31779225		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20671611		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35470975	Associate	★☆☆☆☆ Found in Text Mining only
OKUR-CHUNG NEURODEVELOPMENTAL SYNDROME	Neurodevelopmental Disorders	GENOMICS_ENGLAND_DG	27048600		★☆☆☆☆ Found in Text Mining only
OKUR-CHUNG NEURODEVELOPMENTAL SYNDROME	Neurodevelopmental Disorders	UNIPROT_DG	27048600		★☆☆☆☆ Found in Text Mining only
OKUR-CHUNG NEURODEVELOPMENTAL SYNDROME	Neurodevelopmental Disorders	BEFREE	29383814, 31729156		★☆☆☆☆ Found in Text Mining only
OKUR-CHUNG NEURODEVELOPMENTAL SYNDROME	Neurodevelopmental Disorders	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
OKUR-CHUNG NEURODEVELOPMENTAL SYNDROME	Neurodevelopmental Disorders	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	12778326		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30809532	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34359939	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28270146	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28355289	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20718998		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20718998	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31115532	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11069898, 15634760, 16222144		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	27435858	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27435858	Associate	★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29223351		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	18572023		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	CTD_human_DG	18572023		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16818647	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	15355908		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16222144, 20371694		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31819646		★☆☆☆☆ Found in Text Mining only
Synophrys	Synophrys	HPO_DG			★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	Pubtator	20562896	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25227853	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	25227853	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25227853	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40594996	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	1694965		★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	1694965		★☆☆☆☆ Found in Text Mining only