CSKMT (citrate synthase lysine methyltransferase)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 751071
Gene name Citrate synthase lysine methyltransferase
Gene symbol CSKMT
Synonyms (NCBI Gene)
CS-KMTMETTL12U99HG
Chromosome 11
Chromosome location 11q12.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15 Show/Hide all (15)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
GO:0005759 Component Mitochondrial matrix TAS
GO:0006099 Process Tricarboxylic acid cycle TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617897 33113 ENSG00000214756
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MUP2
Protein name Citrate synthase-lysine N-methyltransferase CSKMT, mitochondrial (CS-KMT) (EC 2.1.1.-) (Methyltransferase-like protein 12, mitochondrial)
Protein function Protein-lysine methyltransferase that selectively trimethylates citrate synthase (CS) in mitochondria (PubMed:28391595, PubMed:28887308). Seems to conduct trimethylation in a highly distributive manner rather than in a processive manner, and thu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13847 Methyltransf_31 73 → 203 Methyltransferase domain Domain
Sequence 
MAALRRMLHLPSLMMGTCRPFAGSLADSCLADRCLWDRLHAQPRLGTVPTFDWFFGYDEV
QGLLLPLLQEAQAASPLRVLDVGCGTSSLCTGLYTKSPHPVDVLGVDFSPVAVAHMNSLL
EGGPGQTPLCPGHPASSLHFMHADAQNLGAVASSGSFQLLLDKGTWDAVARGGLPRAYQL
LSECLRVLNPQGTLIQFSDEDPDVRLPCLEQGSYGWTVTVQELGPFRGITYFAYLIQGSH
Sequence length 240
Interactions View interactions

No strongly related genes found yet for CSKMT.

No additional diseases found yet through genes similar to CSKMT.