Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1443
Gene name	Chorionic somatomammotropin hormone 2
Gene symbol	CSH2
Synonyms (NCBI Gene)	CS-2CSBGHB1PLhCS-B
Chromosome	17
Chromosome location	17q23.3
Summary	The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same t

10 Show/Hide all (10)

miRTarBase ID	miRNA	Experiments
MIRT911872	hsa-miR-3150a-3p	CLIP-seq
MIRT911873	hsa-miR-3175	CLIP-seq
MIRT911874	hsa-miR-4640-5p	CLIP-seq
MIRT911875	hsa-miR-4667-5p	CLIP-seq
MIRT911876	hsa-miR-4700-5p	CLIP-seq
MIRT911877	hsa-miR-4726-5p	CLIP-seq
MIRT911878	hsa-miR-4728-5p	CLIP-seq
MIRT911879	hsa-miR-4768-3p	CLIP-seq
MIRT911880	hsa-miR-665	CLIP-seq
MIRT911881	hsa-miR-939	CLIP-seq

Transcription factor	Regulation	Reference
CEBPB	Unknown	10855690

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005131	Function	Growth hormone receptor binding	IBA
GO:0005131	Function	Growth hormone receptor binding	IEA
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	6930851
GO:0008083	Function	Growth factor activity	IBA
GO:0012505	Component	Endomembrane system	IEA
GO:0031667	Process	Response to nutrient levels	IBA
GO:0031982	Component	Vesicle	IDA	6930851
GO:0031982	Component	Vesicle	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048513	Process	Animal organ development	IBA
GO:0060396	Process	Growth hormone receptor signaling pathway	IBA

MIM	HGNC	e!Ensembl
118820	2441	ENSG00000213218

P0DML3

Protein name

Chorionic somatomammotropin hormone 2 (Choriomammotropin) (Lactogen) (Placental lactogen) (PL)

Protein function

Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00103	Hormone_1	9 → 215	Somatotropin hormone family	Domain

Sequence

MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Sequence length

217

Interactions

View interactions

KEGG Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Hormone signaling
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Growth hormone synthesis, secretion and action

CSH2 (chorionic somatomammotropin hormone 2)

Save This Analysis