CSF2 (colony stimulating factor 2)

Gene

• Entrez ID: 1437
• Gene name: Colony stimulating factor 2
• Gene symbol: CSF2
• Synonyms (NCBI Gene): CSF, GMCSF
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster o

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT736497	hsa-miR-4697-3p	RNA-seq, qRT-PCR	33045840
MIRT911706	hsa-miR-2278	CLIP-seq
MIRT911707	hsa-miR-433	CLIP-seq
MIRT911708	hsa-miR-4660	CLIP-seq
MIRT911709	hsa-miR-4712-3p	CLIP-seq
MIRT911710	hsa-miR-646	CLIP-seq
MIRT1970287	hsa-miR-133a	CLIP-seq
MIRT1970288	hsa-miR-133b	CLIP-seq
MIRT1970289	hsa-miR-1470	CLIP-seq
MIRT1970290	hsa-miR-4281	CLIP-seq
MIRT1970291	hsa-miR-4667-3p	CLIP-seq
MIRT1970287	hsa-miR-133a	CLIP-seq
MIRT1970288	hsa-miR-133b	CLIP-seq
MIRT1970289	hsa-miR-1470	CLIP-seq
MIRT2206234	hsa-miR-1915	CLIP-seq
MIRT1970290	hsa-miR-4281	CLIP-seq
MIRT2206235	hsa-miR-4436b-3p	CLIP-seq
MIRT2206236	hsa-miR-4645-5p	CLIP-seq
MIRT1970291	hsa-miR-4667-3p	CLIP-seq
MIRT2206237	hsa-miR-4673	CLIP-seq
MIRT2206238	hsa-miR-4685-5p	CLIP-seq
MIRT2206239	hsa-miR-4736	CLIP-seq
MIRT2447705	hsa-miR-3688-3p	CLIP-seq
MIRT2447706	hsa-miR-4635	CLIP-seq
MIRT2509453	hsa-miR-548c-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREBBP	Unknown	20439113
CTCF	Unknown	19158269
ETS1	Unknown	12475968
ETS2	Activation	12646185
JUN	Unknown	15840658
NFKB1	Unknown	18285351
RELA	Unknown	18285351
RUNX1	Unknown	20439113

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001821	Process	Histamine secretion	IEA
GO:0001892	Process	Embryonic placenta development	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	3925454, 9722506
GO:0005125	Function	Cytokine activity	IEA
GO:0005129	Function	Granulocyte macrophage colony-stimulating factor receptor binding	IEA
GO:0005129	Function	Granulocyte macrophage colony-stimulating factor receptor binding	TAS	2999978
GO:0005515	Function	Protein binding	IPI	18692472, 25416956, 25910212, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	3925454
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	NAS	1702217
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	18692472
GO:0008083	Function	Growth factor activity	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	9722506
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	10666185
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IDA	19032770
GO:0030099	Process	Myeloid cell differentiation	IBA
GO:0030223	Process	Neutrophil differentiation	IEA
GO:0030224	Process	Monocyte differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IDA	24942581
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030526	Component	Granulocyte macrophage colony-stimulating factor receptor complex	IDA	27396825
GO:0032747	Process	Positive regulation of interleukin-23 production	IDA	20027291
GO:0034021	Process	Response to silicon dioxide	IEA
GO:0034405	Process	Response to fluid shear stress	IEA
GO:0038157	Process	Granulocyte-macrophage colony-stimulating factor signaling pathway	IDA	9722506, 18692472
GO:0042045	Process	Epithelial fluid transport	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0043011	Process	Myeloid dendritic cell differentiation	IDA	16116184
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16606666
GO:0050793	Process	Regulation of developmental process	IEA
GO:0070665	Process	Positive regulation of leukocyte proliferation	IDA	18692472
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071803	Process	Positive regulation of podosome assembly	IDA	15220135
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	24942581
GO:0097028	Process	Dendritic cell differentiation	IDA	21149635
GO:0097028	Process	Dendritic cell differentiation	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	9722506
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	10666185

Other IDs

• MIM: 138960
• HGNC: 2434
• e!Ensembl: ENSG00000164400

Protein

• UniProt ID: P04141
• Protein name: Granulocyte-macrophage colony-stimulating factor (GM-CSF) (Colony-stimulating factor) (CSF) (Molgramostin) (Sargramostim)
• Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
• PDB: 1CSG, 2GMF, 4NKQ, 4RS1, 5C7X, 5D70, 5D71, 5D72, 6BFQ, 6BFS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01109	GM_CSF	18 → 139	Granulocyte-macrophage colony-stimulating factor	Domain

• Sequence:

  MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
  SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
  ESFKENLKDFLLVIPFDCWEPVQE

• Sequence length: 144

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMNESIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, APLASTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APLASTIC ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE MARROW FAILURE DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYELID DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, VISCERAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, AIDS-RELATED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOSITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECT, FOLATE-SENSITIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS X-LINKED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY ALVEOLAR PROTEINOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
5q-syndrome	5q-syndrome	BEFREE	2999978		★☆☆☆☆ Found in Text Mining only
Acidosis Lactic	Lactic acidosis	Pubtator	31924656	Associate	★☆☆☆☆ Found in Text Mining only
Acrania	Acrania	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	11342328, 15328418, 8463313		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	1372766, 17252021, 7845015, 9414269		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10942373, 12912966, 17205058, 19129484, 28535084, 29338593, 29596541, 30626253, 7535143, 8499641, 8600166		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	1290964, 7519043, 8425202		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	11465948, 1387692, 8641372		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	LHGDN	17914409		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	21441929		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	21441929		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	10928085, 10969805, 11030153, 12225397		★☆☆☆☆ Found in Text Mining only
Acute necrotizing encephalopathy	Necrotizing Encephalopathy	BEFREE	31466711		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	3478528, 7658713, 8193361		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11211145, 31233203, 7635448		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	23634280		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	12545248		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	23740935		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17707958		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10720135, 27377463		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12912966, 17205058, 19129484, 28535084, 29596541, 30626253, 7535143, 8499641		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	12012328		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	28637114		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	30771762		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	CTD_human_DG	11732872, 8120554		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	1511064		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	1958376, 9802369		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	17894541		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35523454, 40121165, 9527138	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36142742	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	30155553		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	29282337, 30282352, 31380776, 31463927, 31810489		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	30846386		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	29700775		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amnesia	Amnesia	CTD_human_DG	8877002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	27903811, 28413821, 28453487, 28497179, 28800330, 29017912, 29049480, 29171991, 29282337, 29324921, 29386280, 29467305, 29523644, 29558986, 29898969, 29966201, 30037601, 30055655, 30248592, 30253800, 30348495, 30365556, 30509028, 30605056, 30735665, 30746564, 30747416, 30901713, 30927601, 31118310, 31201430, 31388720, 31491594, 31688040, 31699324, 31759396, 31771069		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20544912, 27741429, 28185258, 28293476, 28334553, 28416596, 28550440, 29212830, 29331073, 29527688, 30116940, 30210445, 30397248, 30405855, 30741620, 30867270, 31721001		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	11605069		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	1728417, 8958788		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CTD_human_DG	11732872, 8297739		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	Pubtator	21859849	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	BEFREE	8237992, 9844760		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Aplastic	Aplastic anemia	Pubtator	11754394, 1375845, 2039816, 2207331, 3042046	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	19859814	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	15308324	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	17711515, 21945571, 33776989	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	7691319		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	17711515, 21945571, 31511058		★☆☆☆☆ Found in Text Mining only
Angioendotheliomatosis	Angioendotheliomatosis	BEFREE	30346252		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	29895893		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	18512784, 28054948		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24942756, 30232221, 30922919		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	3042046	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30336142		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	20727201	Stimulate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	CTD_human_DG	12221670, 9885444		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplastic Anemia	Aplastic anemia	BEFREE	18637807, 8552439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aqueductal Stenosis	Aqueductal Stenosis	BEFREE	28799879, 31069530		★☆☆☆☆ Found in Text Mining only
Arachnoid Cysts	Arachnoid cyst	BEFREE	28287894, 29219781, 30192219, 31488095		★☆☆☆☆ Found in Text Mining only
Arnold Chiari Malformation	Arnold-Chiari malformation	BEFREE	30074451		★☆☆☆☆ Found in Text Mining only
Arnold-Chiari Malformation, Type I	Arnold-Chiari malformation	BEFREE	28291422, 29027876, 29125433, 29125445, 29748208, 30497207, 31197535, 31203396, 31227858		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10217656, 15514212, 1739124, 21159337, 24488984, 9405978, 9409219		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	3042046	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	2026869, 2504878, 29802020, 29975009, 29992549, 3263464		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	33679701	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	30327490	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	24692225, 27159026, 30327490	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	29980703	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	7693825	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	1372187, 16519794, 18513326, 20527084, 2174906, 23577190, 23620516, 24690414, 2504878, 25430993, 25484525, 26062018, 30358109, 30369929, 32005854, 33679701, 37934808, 38372731, 39394168, 9691097	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22403660, 26339358	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28934972, 30279686		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10903212, 1401075, 15826950, 17225724, 17362254, 1885766, 20709516, 20802406, 21605124, 7742019, 8417755, 8835120, 8998072, 9087947, 9525446		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	11522597, 18322230, 21179211, 33626956, 36497064, 36572355, 8575571, 9312165	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12388337, 1530827, 19213775	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	1377084, 8903854		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	1377084	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10217656, 1739124, 21159337, 24488984, 9405978, 9409219		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11238037, 18089573, 33649397	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	37263975	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30611311		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30611311		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	29386280, 29754206		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27217154		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	30152888		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10447777, 24692225, 24890729, 32005854, 33893236, 34285924, 36171010	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11908710, 12896880, 16167889, 18803071, 23190644, 24692225, 25748625, 25803788, 28228272, 28228281, 28777803, 29222492, 29397349, 30196820, 30349541, 31552022		★☆☆☆☆ Found in Text Mining only
Autoimmune polyendocrinopathy syndrome, type 1	Autoimmune Polyendocrinopathy	BEFREE	20966748		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	1588787		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29693141, 8469286, 9081710		★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	BEFREE	28337476, 29746584, 30906945		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	23336215, 33349924	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	29687026, 29895319, 7525676		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	9446667		★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	12449171	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29802040		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16397056, 27486853, 28205361, 29243219, 31385407, 9231915		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	1932751	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1932751, 25047104		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	29196574, 31439491		★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	36809258	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone marrow failure syndrome 1	Bone Marrow Failure Syndrome	CTD_human_DG	2226734		★☆☆☆☆ Found in Text Mining only
Bone marrow failure syndrome 2	Bone Marrow Failure Syndrome	CTD_human_DG	2226734		★☆☆☆☆ Found in Text Mining only
Bone Marrow failure syndromes	Bone marrow failure syndrome	CTD_human_DG	2226734		★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	25278075	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	28119587, 29074982, 30050047		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	25917097, 33658322	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	31500523		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15818382, 29086194, 31491754, 8297651		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10078967, 11891846, 12731089, 12748184, 14767486, 14999770, 15205327, 16927019, 17159986, 20529245, 21997231, 26173622, 2646321, 26621531, 28754674, 29151836, 29230663, 29867922, 29906422, 30018709, 31581558, 31635541, 7514449		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	11325840		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10473803, 15987427, 16984733, 17261184, 19805669, 24026883, 24941346, 26319120, 26621531, 29867922, 30814616, 33066575, 35482127, 40550227	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	26173622	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchitis	Bronchitis	Pubtator	11522597	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	20850939		★☆☆☆☆ Found in Text Mining only
Bulbar palsy	Bulbar palsy	BEFREE	29124441		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	30042946		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29388861, 9081710		★☆☆☆☆ Found in Text Mining only
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	BEFREE	30083957		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	11605069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	14969845, 15613691, 20053669, 27581603, 7635448, 7679411, 9446667		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	8450029	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	26319120	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37904170	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16397056, 27486853, 28205361, 29243219, 3121558, 31385407, 9231915		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	11323095		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11129324, 12708493, 16820947, 17342342, 17596594, 1988125, 27486763, 27998891, 8978294, 9044861		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32239647	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24942756, 25952647, 36306792	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	12225344, 15451464, 27016418, 37919459, 7656270, 8872982, 9108457	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22848476, 27169370, 34177903	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	8450029		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19177198, 19389515, 22228506, 9815777		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	11605069		★☆☆☆☆ Found in Text Mining only
Cardiofaciocutaneous syndrome	Cardiofaciocutaneous syndrome	Pubtator	7514902	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	16584112	Stimulate	★☆☆☆☆ Found in Text Mining only
Cataplexy	Cataplexy	BEFREE	31405906		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	33362776	Associate	★☆☆☆☆ Found in Text Mining only
Central nervous system demyelination	Central Nervous System Demyelination	BEFREE	29568992		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	28526811, 29624145		★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	29439934		★☆☆☆☆ Found in Text Mining only
Cerebellar edema	Cerebellar edema	BEFREE	31227858		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	27903811, 29254099		★☆☆☆☆ Found in Text Mining only
Cerebral Angiitis	Cerebral Angiitis	BEFREE	31211179		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	27693189, 28119587, 29074982, 29226779, 30050047, 30351346		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	BEFREE	27693189, 29226779, 30351346		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	36439158	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral hemorrhage with amyloidosis, hereditary, Dutch type	Cerebral Amyloid Angiopathy	BEFREE	27903811		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	19361262, 30482403		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31481525	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	27128592, 31585427		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19361262, 28107809, 28247411, 28859081, 28971700, 29476447, 29480683, 29576323, 29582975, 29748208, 30428887, 30467214, 30792248, 31059808, 31069530, 31376705, 31721012, 31818229		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	30531317		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	7826216		★☆☆☆☆ Found in Text Mining only
Cervical myelopathy	Cervical myelopathy	BEFREE	31622897		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12912966, 17205058, 19129484, 28535084, 29596541, 30626253, 7535143, 8499641		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	12012328		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	30771762		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34948304, 36883059	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	33627146	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8188522		★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	27558944	Stimulate	★☆☆☆☆ Found in Text Mining only
Chromosome 5q Deletion Syndrome	Chromosome 5q deletion syndrome	Pubtator	2181447	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	12591900, 24327798, 8896413	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	28558308		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	29868028		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28478047		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15927668, 18324964, 18794139, 24836891, 31670207, 8639905		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	10678181, 24469048, 28576879, 29774106		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17681858, 18353856, 20801891, 27516147, 30296713, 31207576, 31320451		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17681858		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	9802707		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	19379606		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	9560101		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	35262594	Stimulate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28535084, 29059494, 31290330		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	29650557	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29128987, 30614807, 30758811, 31530118		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24503766, 31687401		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21129005	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17589921, 28811578, 30892086, 8526901		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	23108143		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10738251, 12855617, 23657083, 24737547, 28223815, 28534709, 29423057, 29456737		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	15289873		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10447777, 16688822, 29770434, 31524146, 33531075	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	15289873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	23108143, 28530155		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Communicating Hydrocephalus	Communicating Hydrocephalus	BEFREE	27773546, 28265819, 28283837, 28304223, 30626626		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	27834628, 30699497		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28338452, 31418647		★☆☆☆☆ Found in Text Mining only
Congenital cerebral hernia	Congenital Cerebral Hernia	BEFREE	28799867, 31157725, 31604132, 31780461		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	2307058		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	36883059	Associate	★☆☆☆☆ Found in Text Mining only
Congenital glucose-galactose malabsorption	Congenital glucose-galactose malabsorption	BEFREE	29700044		★☆☆☆☆ Found in Text Mining only
Congenital meningocele	Congenital Meningocele	BEFREE	30968177		★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	30499904, 7678086		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	11732872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	12645855, 29953616, 30451103, 31003226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Contact Dermatitis	Dermatitis	BEFREE	15349041		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11691814, 12225344, 15451464, 15705910, 18957055, 29734839, 31233203, 9012452, 9108457		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17003932		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17003932		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	37127497	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17003932		★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	BEFREE	31590063		★☆☆☆☆ Found in Text Mining only
Craniorachischisis	Craniorachischisis	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	30463995, 30804212		★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	29142140, 29934424, 31058916, 31206560, 31306078, 31551692		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12840672, 17106921, 19094116, 19230854, 21381154, 21973321, 24503766, 25653427, 27377463, 29216019, 29251350, 29434451, 30124884, 30213581		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19094116, 23749272, 25855658, 29216019, 29434451, 30124884, 31235766	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	28620382		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	10505851, 18593361, 30450100, 31620131		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18026571, 26022954, 26485688	Associate	★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	BEFREE	28799879, 30611152		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	CTD_human_DG	8120554		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15593185, 1915559, 29622035, 8049356, 8853228		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	31470398		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	27662296, 28585290, 30390679, 30862889		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	11834953, 27662296, 27911328, 27989773, 28216393, 28317649, 28346578, 28726050, 28752420, 28826189, 28859081, 29017593, 29318973, 29321235, 29324921, 29387532, 29498578, 29558979, 29614653, 29898969, 30055655, 30083957, 30149454, 30172624, 30351346, 30365556, 30423201, 30509028, 30611311, 30614807, 30770953, 30775992, 30881301, 30987684, 31026486, 31104015, 31104469, 31105644, 31139684, 31345148, 31400306, 31508810, 31802055, 31805990, 31810489, 31836810, 31849573		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	28430012, 28955218, 29061429, 29914023, 31029057		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	33658322	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29527163, 30400098, 30459657, 31108306, 31760473		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29899748		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11121152, 15102074, 15147894, 37930868	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	9185525	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	19890352		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	10831012, 11121152, 13679820, 16487109, 7814618, 9185525, 9881949		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	13679820		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	19211157	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17483299, 22149626, 31370029		★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	BEFREE	27203142, 28009229, 31073783, 31677031		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17483299, 22149626, 29626177, 31370029		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22149626, 34951048	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26268591	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24204704, 29229565	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	26636339	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22149626	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24204704, 28062695		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22149626, 30775988		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	24463275	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26268591	Stimulate	★☆☆☆☆ Found in Text Mining only
Diastematomyelia	Diastematomyelia	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28637114, 29151949		★☆☆☆☆ Found in Text Mining only
Diffuse Mixed-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	30086263		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	27858714, 28413821, 30172624		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28241321		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	8950669		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	28870420		★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	37099426	Associate	★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis Congenita	BEFREE	9773234		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	28131199		★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	30711771		★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	30037601		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	10831012, 11121152, 13679820, 16487109, 9185525, 9881949		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	12112368, 28131199, 28438677, 28535786, 28750305, 29913285, 30253732, 30460450, 31720944, 31805004		★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	BEFREE	31157725, 31604132		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	27730496, 30316638, 31383792		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30816518, 31274231, 8605095		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	21481374, 22365076		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	1421369	Stimulate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	1560199, 17225724, 1885766, 27926989, 30454904, 30691714, 31697804, 8335853, 8353811, 8602991, 8613693, 9525446, 9802369, 9876226		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	16446960, 18322230, 1912580, 19213775, 8666899, 9423810, 9763547, 9798664	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21921589	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	27926989		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27272972, 30253732, 31208341		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	29433947		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19177198, 9815777		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28461757, 9458356		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28461757		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	32947843	Stimulate	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	36159840	Associate	★☆☆☆☆ Found in Text Mining only
Exencephaly	Anencephaly	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Eyelid Diseases	Eye Diseases	CTD_human_DG	17075842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Facial paralysis	Facial paralysis	BEFREE	30058027		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	18509095		★☆☆☆☆ Found in Text Mining only
Familial aplasia of the vermis	Cerebellar vermis agenesis	BEFREE	30611152		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	30340200		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	15964625		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	15964625		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	37179299	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	21664615		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	29727742		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	10566662		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	28643761, 9455809		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	30544390		★☆☆☆☆ Found in Text Mining only
Follicular Cyst	Follicular cyst	Pubtator	22926075	Associate	★☆☆☆☆ Found in Text Mining only
Follicular cyst	Follicular Cyst	BEFREE	8547489		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	27662293, 28263742, 29514947, 29937097, 30714241, 31019994, 31139684, 31847891		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	27858708, 28592456, 30349851, 30906945, 31616982, 31748840		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	11908710, 14663101		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	32947843	Inhibit	★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	10950151		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	30265190		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	22147555, 37703805	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	35045965	Stimulate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	9844760		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	28288328		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29148901		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	28452990		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10550313, 21705618, 26180083, 28411277, 7505398	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	1315829, 16718522, 1701653, 24391839, 28115578, 28411277, 28459367, 29053069, 30235708, 30564626, 30683885, 31485019, 31548426, 9189765		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32908225	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	1315829, 24391839, 28115578, 28411277, 28459367, 29053069, 30235708, 30564626, 30683885, 31485019, 31548426, 9189765		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10550313, 31593589, 9140115	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10910140, 10930096, 11950413, 1377084, 24030977, 24408016, 25677907, 31186691, 7648444		★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	30899093		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	35015822, 7670118	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28236856, 29376890, 30457669, 31585949, 8496391		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	10792393	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	1659535		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	31393333	Stimulate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	27756115, 29110767, 29904402, 29939110, 30544390, 30705347, 30963477, 31382899, 31734909		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	31660990		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10840163, 27486853		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	33419893	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	11732872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	29953616, 31003226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	11732872		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	11432624, 17115221, 3497400	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	14667270, 9675065		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	21632797, 26264606, 8406350		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	12912966		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	30650445		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	30650445	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	30650445		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	27730496		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	15253714	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	34273264	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	29867922	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Coproporphyria	Hereditary Coproporphyria	BEFREE	28265819		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Leukoencephalopathy with Spheroids	Hereditary Diffuse Leukoencephalopathy With Spheroids	BEFREE	30968732		★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	9355965		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1596893, 1951632		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	25470820, 29693141	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24360910, 29074982, 29848382, 30616867, 30687961, 30721650		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	9162223	Associate	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	8188522		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	27773546, 28137972, 28291428, 28314198, 28324680, 28357554, 28686122, 28692063, 29076795, 29350598, 29393809, 29393813, 29435609, 29498604, 29594703, 29624145, 29726777, 29769186, 29957109, 29979129, 29995267, 30032421, 30041005, 30120611, 30259717, 30442699, 30467214, 30611134, 30611152, 30737652, 30947716, 30996058, 31003226, 31025176, 31049668, 31073783, 31134339, 31203396, 31209176, 31227858, 31264489, 31320464, 31359250, 31470398, 31574466, 31783365, 31834371, 31834503		★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	40324076	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus, Normal Pressure	Hydrocephalus	BEFREE	28473344, 28744590, 29103634, 29148901, 29408782, 29520439, 30353860, 30611143, 30937451, 31059212, 31585427		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	2503474		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28821686		★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	8562393		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	11724761	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic syndrome	Hypereosinophilic Syndrome	LHGDN	19050289		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	23987798	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25420919		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	34794403	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	BEFREE	29371243		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	18513326	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	8274733	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	9108457	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24446489, 26994043, 28081975, 28137972, 30611134, 30611152, 31209176, 31370029		★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	31393333		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	31589043		★☆☆☆☆ Found in Text Mining only
Hypoplastic anemia	Hypoplastic anemia	CTD_human_DG	12221670, 9885444		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30459756	Inhibit	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	24374597		★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	8425573		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19117745, 30570135		★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	19230854, 21337672, 21381154		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	LHGDN	14564341		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	40324076	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29704458, 29971001, 30055825		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	12384142, 30468733, 31713345, 9345060		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	20592257, 27330118, 27716663, 27794030, 28124618, 28137972, 28213293, 28554411, 28702344, 28826189, 28942688, 29046879, 29054536, 29096697, 29245058, 29261520, 29415470, 29523644, 29527163, 29859129, 30317034, 30372684, 30614807, 30735665, 30792413, 30820739, 30862889, 30881301, 31075283, 31156534, 31182505, 31278861, 31350262, 31488095, 31508810, 31511058, 31530118, 31628278, 31802039		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	BEFREE	31616366		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11745698, 1370662, 19230854, 21557945, 21953855, 24366884, 29216019, 30124884		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29216019, 30124884, 31235766	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29899748		★☆☆☆☆ Found in Text Mining only
Iniencephaly	Anencephaly	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	28338452		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	35643225	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28916907		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	24692225, 30327490		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	10678181, 12010819, 12384142, 14521811, 15644411, 16371368, 17268534, 18164384, 18422786, 19010541, 19047918, 22315502, 22480363, 23400592, 23620576, 23696637, 24469048, 25047104, 25102944, 26983639, 27418650, 27447965, 28576879, 7672722, 8286744, 9131005, 9185524, 9834232, 9834234		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	CTD_human_DG	22315502		★☆☆☆☆ Found in Text Mining only
Keratosis Seborrheic	Seborrheic keratosis	Pubtator	8450029	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	1951632		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	29868028		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	28651949, 29868028, 37439962	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31875015	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	18753296, 30414800, 31719643		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	12612986, 29868028		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	15451464, 7599037	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	16001164	Inhibit	★☆☆☆☆ Found in Text Mining only
Lateral Sclerosis	Lateral Sclerosis	BEFREE	29331073		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	11732872		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	36771423	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	10540222	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	10540222	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10029601, 10595741, 12855588, 1450413, 15102480, 1536944, 16020509, 1613267, 1638026, 1646047, 1834251, 1835893, 19717467, 2010659, 2198961, 2473799, 2538542, 28694526, 3048441, 3490289, 3491836, 3496132, 3498522, 35999358, 7537932, 7994039, 8142646, 8329702, 8611712, 8879210, 9108392, 9414269	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10880262, 10942373, 10969805, 12200676, 12850480, 14562045, 15459750, 16547503, 19036083, 19717467, 22223820, 2331674, 27569996, 28039843, 30944098, 3491836, 3498522, 8499641, 8978284, 9243295, 9266938, 9345060, 9657759, 9714520		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15927668		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28376863	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10940650, 11509660, 12591900, 15102480, 1688503, 18216869, 1932751, 2307058, 2435341, 7515098, 8453105, 8530445, 8662666	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10340405, 10477734, 10940650, 10942373, 11459169, 11745387, 12663443, 1377054, 15102480, 1613267, 1695108, 1698479, 17115221, 1720040, 18216869, 1825289, 2010659, 21233314, 2153034, 22015065, 2435341, 2473799, 2473802, 2546627, 25538258, 25795133, 26081440, 2665849, 30241179, 3042049, 3048441, 3257144, 3261773, 3264194, 32711425, 3304459, 34840706, 3486012, 3490289, 3491836, 3495305, 6932979, 6967340, 7537932, 7541672, 8114751, 8443379, 8443395, 8805932, 9266938, 9373269, 9414269, 9716596	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19556425	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	11895804, 23632888, 2676012, 8879210	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	11895804, 12010819, 1348434, 1704804, 22753870, 23620576, 23632888, 23696637, 23756559, 2679915, 8286744, 8839857, 9185524, 9596651, 9834232	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	39485070	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15755292	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10435081, 10720135, 10969805, 11465948, 12006512, 12012328, 12200676, 12423681, 12663443, 1387692, 1434798, 1533785, 1690827, 1699903, 1715961, 17252021, 19148132, 1918169, 1961022, 1995312, 20143449, 21441929, 2197515, 22015065, 2207323, 23529188, 2453374, 25538258, 25802083, 27389055, 27581357, 2999978, 30125602, 3044458, 3048441, 31090655, 31115604, 3257144, 3484837, 3490289, 3491836, 3495305, 7516889, 7522290, 7845015, 7967742, 8043435, 8114751, 8182935, 8319777, 8443379, 8486685, 8558916, 8641372, 8916965, 9168435, 9168436, 9266938, 9292531, 9345050, 9345060, 9657759, 9675065, 9680365, 9792291		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12031914		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	21441929		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	12384142, 25575034, 28576879, 29296739, 9834234		★☆☆☆☆ Found in Text Mining only
Leukocyte Disorders	Leukocyte disorders	Pubtator	18209075	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukocyte Disorders	Leukocyte disorders	Pubtator	29602801	Associate	★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	24128683		★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	24128683, 30968732		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	10607719, 12804646, 16912178, 27927023, 28437295, 7678086, 9773234		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	27794030, 29672930, 30083957, 30149288, 30440090, 30471248, 31051162, 31189032, 31293044, 31422676		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30935694		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11295284, 11916239, 12508355, 12833133, 14969845, 20679198, 26021873, 28166197, 30205709		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	34273264	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	34367180, 36159788	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36159788	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11295284, 11880183, 11916239, 12731087, 12833133, 17326190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	17326190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Low Grade Lymphoma (neoplasm)	Low Grade Lymphoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	28452990, 29178525		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	12114209, 25513711, 29562615, 38507932	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	21036914, 24279725, 28233860, 8676086		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	12805087, 29592982, 30013577		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11129324, 12708493, 22797725, 22848476, 26912193, 27835886, 34498383, 7506922, 7591964, 8144399	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12926133, 16211258		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25034886		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19479852, 25652333, 27110576, 27412348	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19644848	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19479852, 22324944, 25652333, 29943843, 30563424		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16203990, 27016418	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	29208342		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	31400073		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	29338593		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10502821, 2331674, 30619796, 31088767, 9162223		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16041313	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	2557316	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Lymphoma, Intermediate-Grade	Intermediate Grade Lymphoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell	Lymphoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	11855781		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	9162223		★☆☆☆☆ Found in Text Mining only
Lymphoma, Undifferentiated	Lymphoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	28459367		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	9162223	Associate	★☆☆☆☆ Found in Text Mining only
Lysinuric Protein Intolerance	Lysinuric Protein Intolerance	BEFREE	21110863, 28512724		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	29498604		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29063349, 29895893, 30041075		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	31015342		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16718522, 29296736		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	10840163, 27486853		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	2787682, 9610913		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10078967, 11891846, 12748184, 14767486, 14999770, 15205327, 16927019, 17159986, 21997231, 26173622, 2646321, 26621531, 28754674, 29151836, 29230663, 29867922, 29906422, 30018709, 31581558, 31635541, 7514449		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	11325840		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30816518, 31274231, 8605095		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28461757		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	10950151, 11691814, 12738749		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	11323095		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	17326190		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11129324, 12708493, 16820947, 17342342, 17596594, 1988125, 27486763, 27998891, 7679411, 8978294, 9044861		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30935694		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19389515, 22228506		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22698406, 27184426, 30232221, 30814617		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10537292, 10950151, 12746848, 15598439, 15704001, 15963916, 16831072, 16962494, 17707059, 18303206, 28241742, 28797844, 7927924, 9446667		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28274999, 28943964		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16397056, 27486853, 28205361, 29243219, 31385407, 9231915		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10092001, 10502821, 10537292, 10840163, 10950151, 11211145, 12048160, 12225344, 15705910, 16912178, 16962494, 1825026, 18957055, 19459853, 19890352, 20381405, 21540457, 21630267, 22988839, 23108143, 23526884, 24366884, 25584002, 26803055, 27039846, 27734153, 28240048, 28320147, 28582842, 28686055, 29048610, 29075565, 29596541, 29963274, 30013322, 30075184, 30232221, 308840, 31233203, 31581558, 31834830, 8149602, 9168436, 9192768, 9741424, 9815891		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	30239270		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	11023201		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17589921, 28811578, 30892086		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	11325840		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	11325840		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12748184, 19805669, 20127358, 28282575, 29867922		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	11325840		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	29124441		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	30771762		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10078967, 10505851, 10930096, 11676397, 11950413, 12396624, 16713660, 16718522, 18593361, 19915919, 24973616, 25034886, 25286079, 25821063, 26803055, 28536308, 28589085, 29414294, 30450100, 31143509, 31171039, 31620131, 7847808, 8921947, 9143914, 9336741, 9816095		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	10779161, 11676397, 19903780, 22021080, 7750125, 7849318, 9111579	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	11061616		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	35538545, 8642353	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	30450100	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35432383	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanosis	Melanosis	BEFREE	29948137		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	12117909	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	29188303, 30717035		★☆☆☆☆ Found in Text Mining only
Meningoencephalocele	Meningoencephalocele	BEFREE	30968177		★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	29521607, 30497223, 31574465		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29527163, 30400098, 30459657, 31108306, 31760473		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28337476, 30682327		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	29602801	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	2787682	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	36078120	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29019365		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	27146699, 28000169, 30769926, 7536122, 7648437, 9524710, 9789055		★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	39672520	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	18577287, 20592257, 28179036, 28189924, 28213293, 28216393, 28223932, 28236166, 28239639, 28344552, 28346578, 28441967, 28527210, 28861336, 28899429, 28979205, 29017593, 29061429, 29081416, 29128987, 29179578, 29245058, 29415470, 29458036, 29499171, 29558986, 29562515, 29914031, 30055655, 30149454, 30207231, 30297997, 30337152, 30447377, 30509028, 30524269, 30611311, 30614806, 30614807, 30775992, 30794315, 30847669, 30881301, 30903419, 30906244, 30958366, 30987684, 31010420, 31026486, 31104027, 31121601, 31152032, 31156534, 31166546, 31252287, 31350262, 31353852, 31371645, 31388720, 31424398, 31463927, 31491594, 31511058, 31526625, 31634898, 31795039, 31801648, 31805990, 31849573		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	11775253, 29616857		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30776296		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	27271921		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	28543098, 29132035, 29392518, 30167879, 31802039		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	28478047, 28572287		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	30116031		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	35421271	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	29764386		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	31500523		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis Type IIIA	Mucopolysaccharidosis	BEFREE	31104888		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	14663101		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	9192847		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16001164, 7537117		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	16001164	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	2265252, 9054668, 9345032, 9734660, 9792304	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	7540856, 8104070, 8555506		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	23620516, 25278028, 25756873, 28301515, 28336414, 29290406, 30327490, 31332391, 32005854, 33037101, 33658322, 34285924	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25278028, 25458313, 25803788, 26439963, 27699930, 27911122, 28082233, 28207850, 28336414, 28495137, 28522366, 28543098, 28578025, 28627962, 28641926, 28695148, 28755681, 29059494, 29068494, 29079686, 29090607, 29132035, 29174194, 29392518, 29408796, 29414294, 29457657, 29511863, 29687026, 29873030, 29957390, 30142535, 30167879, 30196820, 30196829, 30216414, 30327490, 30367882, 30386877, 30610965, 30619038, 30697184, 31024547, 31043476, 31170500, 31305892, 31383928, 31471502, 31501228, 31558148, 31645473, 31715425, 31802039, 8765339		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	25917097, 25972006	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	27787906, 28802830, 31305892, 31675639		★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	31432428		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	10447777, 22907239, 26826242	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	22907239	Inhibit	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	33968070	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	1353646		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11122148, 11775253, 12962720, 1353646, 15728248, 1690318, 18637807, 2187337, 2331674, 25538258, 25802083, 2676013, 28074192, 28576879, 29616857, 7509225, 7858491, 8237992, 8598233, 9266938, 9714520, 9793271		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	2999978		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10606893, 1421369, 2676013	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11122148, 15541478, 16091127, 1698477, 18216869, 30241179, 3042046, 8704190, 9332304	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	2307058, 8662666, 9168435, 9243295		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10390193, 10843748, 12145689, 1311195, 14520439, 14525781, 1533785, 16580068, 17090651, 2043482, 24041577, 29023488, 3491836, 7492787, 7690436, 8350620, 8563750, 9639411, 9808576		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	24469048, 8563750, 9808576		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	12645855		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Transient myeloproliferative disorder	Pubtator	20064153	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	11732872		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17640962, 18832728, 28978634		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29953616		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	32963156	Associate	★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	28453487, 30372684, 30903419, 31424398		★☆☆☆☆ Found in Text Mining only
Narcolepsy type 1	Narcolepsy	BEFREE	30387527, 31405906, 31756639		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	16446960	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	1702652, 18352974, 1958376, 23406597, 29561922, 8521179, 9761019		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	26067893	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18999931, 28732079		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21543473, 28732079	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10078967, 10233685, 10449617, 10466632, 10536177, 10597195, 10679114, 10797297, 10811863, 10866317, 11023201, 11122109, 11325840, 11368443, 11544306, 11571536, 11691814, 11708879, 11735339, 11836673, 11916239, 11983866, 12225344, 12396624, 12579310, 12748184, 12788649, 12932654, 1315829, 14634087, 14667270, 14715418, 14730331, 14970281, 15027115, 15340764, 15451464, 15705910, 15818382, 15899826, 15963916, 16001161, 16019851, 16397056, 16450393, 16525479, 16713660, 16820947, 16912178, 16971804, 1701653, 17096339, 17487349, 17620425, 17822323, 17965776, 18452266, 18473731, 18495536, 18957055, 18999931, 19008459, 19517218, 1968360, 19805669, 20147862, 21159637, 21208907, 21327637, 21424118, 21626603, 2162848, 21854753, 22186789, 22200506, 22266191, 22349830, 22698406, 22698407, 22988839, 23108143, 23352035, 23634280, 23811319, 24324073, 24737547, 25034886, 25381801, 25538258, 25714011, 25900822, 26049545, 26803055, 27184426, 27389055, 28089377, 28166197, 28176947, 28240048, 28336378, 28409732, 28497184, 28530155, 28572167, 28598276, 28623761, 28643761, 28694526, 28732079, 28797844, 28951871, 29177676, 29434585, 29435154, 29569742, 29669721, 29867922, 29882703, 29900557, 29959142, 30004280, 30205709, 30235708, 30265190, 30504718, 30519342, 30538109, 30611134, 30747725, 30892086, 30922919, 31059598, 31064334, 31186691, 3119535, 31273954, 31297382, 31376705, 31467912, 31477437, 31548293, 31620131, 3539201, 7679411, 7691144, 7734955, 8137291, 8418381, 8485707, 8607020, 8704254, 8820364, 8826937, 8864754, 9108457, 9143914, 9189765, 9192768, 9218594, 9226179, 9414129, 9455809, 9568072, 9625251, 9652792, 9721877, 9734660, 9741424, 9764578, 9808567, 9815891, 9816095, 9989489		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	25802083		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28082233, 28991699, 29059494, 29212830, 31464088		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	12962720, 1421369, 2403822, 25538258, 3042046	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural Tube Defect	CTD_human_DG	17075842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural Tube Defect	BEFREE	28695418		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurenteric Cyst	Neurenteric Cyst	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1377084, 16682723, 30629318		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	1377084, 24644014, 30629318, 36822669	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	35839426	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurocutaneous Syndromes	Neurocutaneous Syndromes	BEFREE	28265819		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	25737095, 28137972, 28486988, 29353355, 29508283, 29704639, 29937097, 29948175, 30174644, 30248592, 30283455, 30348495, 30353860, 30635782, 30758811, 30858094, 31068645, 31093802, 31167811, 31414383, 31432418, 31432428, 31721540		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	30142535, 30248527, 30426010, 31471502, 31645473		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29222126		★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	29846157, 30418114		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	10607719, 12804646, 16912178, 27927023, 28437295, 7678086, 9773234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	Pubtator	10607719, 19859814, 28376863, 8652846	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	Pubtator	10792393	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	CTD_human_DG	11264156, 7875148		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	Pubtator	27695085	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	2405922, 7693032	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	2503474, 28459367, 31400073		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12926133, 14667270, 14970281, 15963916, 16410826, 17599645, 2162848, 25919140, 31797203		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	16046292		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36572355	Associate	★☆☆☆☆ Found in Text Mining only
Obstructive Hydrocephalus	Obstructive Hydrocephalus	BEFREE	28799879, 29708982		★☆☆☆☆ Found in Text Mining only
Opsoclonus-Myoclonus Syndrome	Opsoclonus-myoclonus syndrome	BEFREE	29685330, 29727049		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	29305439, 31061727, 31715425		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	11545238		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	16482498		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	29979129		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	25470448		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	12074592		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	18463784, 30142160		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	15031532	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	2162848		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	1752777	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19389515, 22228506		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	1502188, 1752777	Associate	★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	16482498		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22698406, 27184426, 30232221, 30814617, 9568072, 9652792		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25691328, 30922919		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	25042001		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15289501, 21217520, 23924790, 25945796, 26842750, 32591464	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	2676013, 7686032		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	Pubtator	2676013	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28081975		★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	BEFREE	28934871, 30045288, 30074451, 30653369, 31176474		★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic Syndromes	BEFREE	29103425		★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	32771066	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	10329758	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	8785452	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	25737095, 28179466, 28179471, 28244186, 28330963, 28554411, 28604235, 28750675, 28800113, 28821274, 29046879, 29141588, 29170290, 29331073, 29501577, 29626177, 29783988, 30089615, 30248592, 30381367, 30390673, 30450079, 30504429, 30532185, 30814322, 30981640, 30983487, 31054380, 31278861, 31293044, 31484712, 31703585, 31721001		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34955458	Stimulate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	29436735, 29843235, 30383831, 30423201, 31737952		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28179466, 29111028, 29843235, 31070772		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	11530804, 15197238		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	25691328		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35262594, 37240180	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29141087		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28601860, 29846157		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28601860, 29846157		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	1951632		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30083957		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	29937097, 30714241, 31019994, 31139684, 31847891		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	28778803		★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	BEFREE	28101825, 28281443, 28716286, 29306858, 29312139, 29364387, 29408878, 29423617, 29443773, 29483006, 29540199, 29770929, 29856136, 29932377, 30300850, 30430892, 30482402, 30669985, 30708338, 30951880, 31022232, 31062226		★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	29282336		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	27345569		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	17713553, 22403660, 24463275		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	LHGDN	17713553		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	24463275	Associate	★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	20966748		★☆☆☆☆ Found in Text Mining only
Posterior cortical atrophy syndrome	Posterior cortical atrophy	BEFREE	30340200, 31319885		★☆☆☆☆ Found in Text Mining only
Posterior reversible encephalopathy syndrome	Leukoencephalopathy	BEFREE	27848124		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	3491836		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	28535084		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10942373, 29338593, 7535143, 8600166		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10340398, 16611416		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	11834953, 27662296, 27911328, 27989773, 28216393, 28317649, 28346578, 28726050, 28752420, 28826189, 28859081, 29017593, 29318973, 29321235, 29324921, 29387532, 29498578, 29614653, 29898969, 30037601, 30055655, 30083957, 30149454, 30172624, 30351346, 30365556, 30423201, 30509028, 30611311, 30614807, 30770953, 30775992, 30881301, 30987684, 31026486, 31104015, 31104469, 31105644, 31345148, 31508810, 31802055, 31805990, 31810489, 31836810, 31849573		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	28521029, 29151949, 29327175, 29986691, 30564626, 31064334		★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	27858708, 28179468, 29444966, 29514947, 30282352, 30640253		★☆☆☆☆ Found in Text Mining only
Progressive bulbar palsy	Bulbar palsy	BEFREE	29124441		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	29282336, 29514947, 29948175, 30390673		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	25015355, 31659187		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10537292, 10950151, 12746848, 15598439, 15704001, 15963916, 16831072, 16962494, 17707059, 18303206, 28241742, 28797844, 7927924, 9446667		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18303206, 31348843, 33753096, 35133464, 8308972	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	28212403		★☆☆☆☆ Found in Text Mining only
Pseudotumor Cerebri	intracranial hypertension	BEFREE	28137972, 28960170, 29078127, 29305439, 29519787, 29724759, 31122204, 31325030, 31352494, 31832847		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19890352, 28777803, 29676778, 29899748, 30207587		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	30279686	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	7744320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	10706504, 10779401, 11930665, 12805087, 12896880, 14567558, 16275889, 16337108, 17848583, 18803071, 18955567, 18955570, 19015311, 19666756, 20338813, 20622029, 20623372, 20966748, 21036914, 21075760, 21110863, 21262803, 21849033, 24044676, 24279752, 26077231, 26264606, 28013480, 28212655, 28233860, 28421817, 28489415, 28489417, 28860566, 29397349, 29434585, 29969365, 30087322, 30113436, 30846703, 30866900, 31002528, 31365379, 31513019, 31827650, 8609219, 8676086, 9412586, 9694696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	12896880, 14567558, 16507860, 18216869, 21849033, 23620516, 24279752, 26264606, 28212655, 35319722, 36809258, 9763547, 9929010	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	LHGDN	14512323, 14567558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	9929010	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis Acquired	Pulmonary alveolar proteinosis	Pubtator	30845238, 32188922, 9763547	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary alveolar proteinosis congenital	Pulmonary alveolar proteinosis	Pubtator	21849033	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary alveolar proteinosis, congenital	Congenital pulmonary alveolar proteinosis	BEFREE	21849033		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12594295, 17681858, 18353856, 19213775, 20381852, 31207576	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	17894541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	19729668	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	9881949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulsatile Tinnitus	Pulsatile Tinnitus	BEFREE	31023664		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	7744320		★☆☆☆☆ Found in Text Mining only
Radiation Syndrome	Radiation Syndrome	BEFREE	30539167		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	1676079		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	10950151, 11691814, 12738749		★☆☆☆☆ Found in Text Mining only
Renal carnitine transport defect	Renal Carnitine Transport Defect	BEFREE	31511058		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11691814, 12225344, 15451464, 15705910, 16709811, 18957055, 29734839, 31233203, 9012452, 9108457		★☆☆☆☆ Found in Text Mining only
Residual Tumor	Residual Tumor	CTD_human_DG	14654953		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	28826916, 29652170, 30113436, 9694696		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	27118435	Associate	★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	CTD_human_DG	11486401, 11732872, 7680712		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	34794403	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	9933455	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	16397056		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10470256, 11426018, 12571844, 1320571, 15535838, 15593185, 16519794, 16778989, 16859503, 17062647, 17101062, 17892600, 18513326, 1915559, 2026869, 21613310, 22385242, 2504878, 25652333, 25803788, 28144129, 28213566, 28369741, 28777803, 28898718, 28941039, 29069507, 29254845, 29431121, 29563337, 30358109, 30804924, 30999929, 31037071, 8019788, 8049356, 8853228, 9117172		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	22446963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	BEFREE	9876226		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	33626956	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10201051, 8303629, 8893383		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	12746045, 23384655, 7586698	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	8303629	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	8303629	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	CTD_human_DG	11605069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	2171188, 24374597, 9143914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	25805798	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	25805798	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	25805798	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	CTD_human_DG	11605069		★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	CTD_human_DG	11605069		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17522711, 18547720, 19281803, 27734750, 30935700		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17522711		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	15801021		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	11710721, 32538493	Associate	★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	8450029		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28530155		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	30327490, 35720398	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29225343, 29387728, 29540199, 30327490, 31220157, 8430456		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	7691324		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	30125602, 9764578		★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	BEFREE	29363350, 30497227		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	9761019		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	19404300	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	10597195		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	19479852	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases Vascular	Skin disease	Pubtator	1997656	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	20392292, 29149388		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	11583982, 34768877	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28329084, 30597615, 30794315		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	30037601		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10360828		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	1830497, 3018738, 35583004	Associate	★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	31574475		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	28566180, 29196574, 31439491		★☆☆☆☆ Found in Text Mining only
Spinal Cord Myelodysplasia	Spinal Cord Myelodysplasia	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Spinal Cord Neoplasms	Spinal Cord Neoplasms	BEFREE	31297382		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	30721650		★☆☆☆☆ Found in Text Mining only
SPINAL MUSCULAR ATROPHY WITH RESPIRATORY DISTRESS 1	SPINAL MUSCULAR ATROPHY WITH RESPIRATORY DISTRESS	BEFREE	31445043		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	29142230		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	25142923, 28054948, 32765525	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	27903811, 29386280		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10408389, 11023201, 16912178, 6982994, 9815891		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16912178		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31794546, 31894857, 32623386, 33419893, 35267186, 36505439	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23870818		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	308840		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10416612, 10840163, 16912178, 23634280, 9721877		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21664615		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	24374597		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28274999, 28943964		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10333716, 18452266, 33763491, 37865637	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	11545238		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	37263975	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27128592, 27759738, 27931120, 29110771, 29594703, 30306357, 30361489, 30482403, 31073783, 31415399, 31738583, 31811640, 31812149		★☆☆☆☆ Found in Text Mining only
Surfactant Metabolism Dysfunction Pulmonary 1	Pulmonary surfactant metabolism dysfunction	Pubtator	24279752	Inhibit	★☆☆☆☆ Found in Text Mining only
Surfactant Metabolism Dysfunction Pulmonary 1	Pulmonary surfactant metabolism dysfunction	Pubtator	28212655	Associate	★☆☆☆☆ Found in Text Mining only
Surfactant Metabolism Dysfunction, Pulmonary, 4	Surfactant Metabolism Dysfunction, Pulmonary	BEFREE	24279725		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	24714374		★☆☆☆☆ Found in Text Mining only
Syringomyelia	Syringomyelia	BEFREE	28338452, 28729294, 29027876, 29316818, 30074451, 30497207, 31675698		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	30305171		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	15801021, 22324944		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	8485042		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	16397056		★☆☆☆☆ Found in Text Mining only
Tay-Sachs Disease	Tay-Sachs Disease	BEFREE	31432418		★☆☆☆☆ Found in Text Mining only
Tethered Cord Syndrome	Primary Tethered cord syndrome	CTD_human_DG	17075842		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	2010654	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	24463275	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	1676079, 22911897		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	11432624	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	20966748		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16203990	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17022149		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29953504, 37705974	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	16397056		★☆☆☆☆ Found in Text Mining only
Trichiasis	Trichiasis	BEFREE	20015396		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	31834371		★☆☆☆☆ Found in Text Mining only
Tumor Lysis Syndrome	Tumor Lysis Syndrome	BEFREE	28378140		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	8950669		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31504528		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	11605069		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	29063349		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30310111, 32277695, 35386697	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	31121496	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10079255, 17177206, 26257474, 36973995	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	10566662		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	35061677	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis Anterior	Anterior uveitis	Pubtator	31763950	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	12114209	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	21159637, 28550897		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	10792393	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	29208342, 31421586		★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	29439934	Inhibit	★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	29256819		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	27110576	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	LHGDN	12615367		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	15095274, 30651813		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	9077486	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	15095274, 30651813		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	15728466		★☆☆☆☆ Found in Text Mining only