CSAG1 (chondrosarcoma associated gene 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 158511
Gene name Chondrosarcoma associated gene 1
Gene symbol CSAG1
Synonyms (NCBI Gene)
CSAGECT24.1
Chromosome X
Chromosome location Xq28
Summary This gene encodes a member of a family of tumor antigens. The protein is expressed in chondrosarcomas, but may also be expressed in normal tissues such as testis. Alternative splicing of this gene results in two transcript variants encoding the same prote
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT046741 hsa-miR-222-3p CLASH 23622248
MIRT038725 hsa-miR-93-3p CLASH 23622248
MIRT038615 hsa-miR-186-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IDA 32295846
GO:0000922 Component Spindle pole IEA
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IDA 32295846
GO:0005813 Component Centrosome IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300944 24294 ENSG00000198930
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6PB30
Protein name Chondrosarcoma-associated gene 1 protein (Cancer/testis antigen 24.1) (CT24.1) (Cancer/testis antigen CSAGE)
Protein function May play an important role in maintaining centrosome integrity during mitosis.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in chondrosarcoma, melanoma, cartilage and testis, but not in other normal tissues. {ECO:0000269|PubMed:12039054}.
Sequence 
MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQ
PRREKGPVKEVPGTKGSP
Sequence length 78
Interactions View interactions

No strongly related genes found yet for CSAG1.

No additional diseases found yet through genes similar to CSAG1.