CROCCP3 (CROCC pseudogene 3)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 114819 |
| Gene name | CROCC pseudogene 3 |
| Gene symbol | CROCCP3 |
| Synonyms (NCBI Gene) |
CROCCL2dJ798A10.2
|
| Chromosome | 1 |
| Chromosome location | 1p36.13 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8IVE0 |
| Protein name | Putative ciliary rootlet coiled-coil protein-like 2 protein (Ciliary rootlet coiled-coil protein pseudogene 3) |
| Family and domains | |
| Sequence |
MRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDSTMQAHEDAQREVQRLRSA |
| Sequence length | 287 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with CROCCP3 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to CROCCP3 (see Related Genes above), that are NOT already directly curated for CROCCP3 itself -- a lead worth checking, not a confirmed association.
0
|
|