CRISPLD1 (cysteine rich secretory protein LCCL domain containing 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 83690
• Gene name: Cysteine rich secretory protein LCCL domain containing 1
• Gene symbol: CRISPLD1
• Synonyms (NCBI Gene): CRISP-10, CRISP10, LCRISP1
• Chromosome: 8
• Chromosome location: 8q21.13

miRNA Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT909813	hsa-miR-1	CLIP-seq
MIRT909814	hsa-miR-181a	CLIP-seq
MIRT909815	hsa-miR-181b	CLIP-seq
MIRT909816	hsa-miR-181c	CLIP-seq
MIRT909817	hsa-miR-181d	CLIP-seq
MIRT909818	hsa-miR-206	CLIP-seq
MIRT909819	hsa-miR-2116	CLIP-seq
MIRT909820	hsa-miR-23a	CLIP-seq
MIRT909821	hsa-miR-23b	CLIP-seq
MIRT909822	hsa-miR-23c	CLIP-seq
MIRT909823	hsa-miR-345	CLIP-seq
MIRT909824	hsa-miR-34c-3p	CLIP-seq
MIRT909825	hsa-miR-3688-3p	CLIP-seq
MIRT909826	hsa-miR-3908	CLIP-seq
MIRT909827	hsa-miR-3942-5p	CLIP-seq
MIRT909828	hsa-miR-4262	CLIP-seq
MIRT909829	hsa-miR-4307	CLIP-seq
MIRT909830	hsa-miR-4639-5p	CLIP-seq
MIRT909831	hsa-miR-4699-3p	CLIP-seq
MIRT909832	hsa-miR-4703-5p	CLIP-seq
MIRT909833	hsa-miR-4714-5p	CLIP-seq
MIRT909834	hsa-miR-4760-5p	CLIP-seq
MIRT909835	hsa-miR-4766-3p	CLIP-seq
MIRT909836	hsa-miR-485-3p	CLIP-seq
MIRT909837	hsa-miR-556-3p	CLIP-seq
MIRT909838	hsa-miR-613	CLIP-seq
MIRT1969662	hsa-miR-1303	CLIP-seq
MIRT909820	hsa-miR-23a	CLIP-seq
MIRT909821	hsa-miR-23b	CLIP-seq
MIRT909822	hsa-miR-23c	CLIP-seq
MIRT1969663	hsa-miR-4328	CLIP-seq
MIRT1969664	hsa-miR-4659a-3p	CLIP-seq
MIRT1969665	hsa-miR-4659b-3p	CLIP-seq
MIRT1969666	hsa-miR-4729	CLIP-seq
MIRT909826	hsa-miR-3908	CLIP-seq
MIRT2205771	hsa-miR-4291	CLIP-seq
MIRT2205772	hsa-miR-4492	CLIP-seq
MIRT2205773	hsa-miR-4498	CLIP-seq
MIRT1969664	hsa-miR-4659a-3p	CLIP-seq
MIRT1969665	hsa-miR-4659b-3p	CLIP-seq
MIRT2205774	hsa-miR-545	CLIP-seq
MIRT2205775	hsa-miR-659	CLIP-seq
MIRT2205776	hsa-miR-762	CLIP-seq
MIRT2427986	hsa-miR-4289	CLIP-seq
MIRT2427987	hsa-miR-499-3p	CLIP-seq
MIRT2427988	hsa-miR-499a-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0060325	Process	Face morphogenesis	IEA
GO:0060325	Process	Face morphogenesis	IMP	21254358
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9H336
• Protein name: Cysteine-rich secretory protein LCCL domain-containing 1 (CocoaCrisp) (Cysteine-rich secretory protein 10) (CRISP-10) (LCCL domain-containing cysteine-rich secretory protein 1) (Trypsin inhibitor Hl)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00188	CAP	66 → 206	Cysteine-rich secretory protein family	Domain
  PF03815	LCCL	394 → 491	LCCL domain	Domain
  PF03815	LCCL	293 → 384	LCCL domain	Domain

• Sequence:

  MKCTAREWLRVTTVLFMARAIPAMVVPNATLLEKLLEKYMDEDGEWWIAKQRGKRAITDN
  DMQSILDLHNKLRSQVYPTASNMEYMTWDVELERSAESWAESCLWEHGPASLLPSIGQNL
  GAHWGRYRPPTFHVQSWYDEVKDFSYPYEHECNPYCPFRCSGPVCTHYTQVVWATSNRIG
  CAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGRPCSACPPSFGGGCRENLC
  YKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSRNEVISAQQMSQIVSCEVRLR
  DQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNDGGWVDITRQGR
  KHYFIKSNRNGIQTIGKYQSANSFTVSKVTVQAVTCETTVEQLCPFHKPASHCPRVYCPR
  NCMQANPHYARVIGTRVYSDLSSICRAAVHAGVVRNHGGYVDVMPVDKRKTYIASFQNGI
  FSESLQNPPGGKAFRVFAVV

• Sequence length: 500

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
COLON CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASM	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	33111402	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30896821	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	31262291	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30896821	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30096456		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30096456		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30096456		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for CRISPLD1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CRISPLD1.