CRIP1 (cysteine rich protein 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1396
• Gene name: Cysteine rich protein 1
• Gene symbol: CRIP1
• Synonyms (NCBI Gene): CRHP, CRIP, CRP-1, CRP1
• Chromosome: 14
• Chromosome location: 14q32.33
• Summary: Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhomboti

miRNA Show/Hide all (44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT909639	hsa-miR-1233	CLIP-seq
MIRT909640	hsa-miR-1254	CLIP-seq
MIRT909641	hsa-miR-1256	CLIP-seq
MIRT909642	hsa-miR-1285	CLIP-seq
MIRT909643	hsa-miR-3116	CLIP-seq
MIRT909644	hsa-miR-3144-5p	CLIP-seq
MIRT909645	hsa-miR-3152-5p	CLIP-seq
MIRT909646	hsa-miR-3187-5p	CLIP-seq
MIRT909647	hsa-miR-3191	CLIP-seq
MIRT909648	hsa-miR-3690	CLIP-seq
MIRT909649	hsa-miR-3922-5p	CLIP-seq
MIRT909650	hsa-miR-3945	CLIP-seq
MIRT909651	hsa-miR-4253	CLIP-seq
MIRT909652	hsa-miR-4278	CLIP-seq
MIRT909653	hsa-miR-4292	CLIP-seq
MIRT909654	hsa-miR-4652-5p	CLIP-seq
MIRT909655	hsa-miR-4667-5p	CLIP-seq
MIRT909656	hsa-miR-4688	CLIP-seq
MIRT909657	hsa-miR-4700-5p	CLIP-seq
MIRT909658	hsa-miR-4720-5p	CLIP-seq
MIRT909659	hsa-miR-4774-3p	CLIP-seq
MIRT909660	hsa-miR-4799-3p	CLIP-seq
MIRT909661	hsa-miR-612	CLIP-seq
MIRT909662	hsa-miR-637	CLIP-seq
MIRT909663	hsa-miR-661	CLIP-seq
MIRT909639	hsa-miR-1233	CLIP-seq
MIRT909641	hsa-miR-1256	CLIP-seq
MIRT909642	hsa-miR-1285	CLIP-seq
MIRT909644	hsa-miR-3144-5p	CLIP-seq
MIRT909646	hsa-miR-3187-5p	CLIP-seq
MIRT909647	hsa-miR-3191	CLIP-seq
MIRT909649	hsa-miR-3922-5p	CLIP-seq
MIRT909650	hsa-miR-3945	CLIP-seq
MIRT909651	hsa-miR-4253	CLIP-seq
MIRT909652	hsa-miR-4278	CLIP-seq
MIRT909653	hsa-miR-4292	CLIP-seq
MIRT909654	hsa-miR-4652-5p	CLIP-seq
MIRT909655	hsa-miR-4667-5p	CLIP-seq
MIRT909656	hsa-miR-4688	CLIP-seq
MIRT909657	hsa-miR-4700-5p	CLIP-seq
MIRT909658	hsa-miR-4720-5p	CLIP-seq
MIRT909660	hsa-miR-4799-3p	CLIP-seq
MIRT909661	hsa-miR-612	CLIP-seq
MIRT909662	hsa-miR-637	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IDA	9126610, 9507743, 20415737
GO:0006955	Process	Immune response	IEP	20415737
GO:0007507	Process	Heart development	TAS	7999070
GO:0008270	Function	Zinc ion binding	IBA
GO:0008270	Function	Zinc ion binding	IDA	9126610
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IDA	20415737
GO:0010043	Process	Response to zinc ion	IDA	7999070
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEP	7999070
GO:0042277	Function	Peptide binding	IDA	18670594
GO:0046872	Function	Metal ion binding	IEA
GO:0060741	Process	Prostate gland stromal morphogenesis	IEP	9507743
GO:0071236	Process	Cellular response to antibiotic	IDA	20415737
GO:0071493	Process	Cellular response to UV-B	IDA	20415737

Other IDs

• MIM: 123875
• HGNC: 2360
• e!Ensembl: ENSG00000213145

Protein

• UniProt ID: P50238
• Protein name: Cysteine-rich protein 1 (CRP-1) (Cysteine-rich heart protein) (CRHP) (hCRHP) (Cysteine-rich intestinal protein) (CRIP)
• Protein function: Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	4 → 61	LIM domain	Domain

• Sequence:

  MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAM
  FGPKGFGRGGAESHTFK

• Sequence length: 77

Related Genes

No strongly related genes found yet for CRIP1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CRIP1.