CREM (cAMP responsive element modulator)

Gene

• Entrez ID: 1390
• Gene name: CAMP responsive element modulator
• Gene symbol: CREM
• Synonyms (NCBI Gene): CREM-2, ICER, hCREM-2
• Chromosome: 10
• Chromosome location: 10p11.21
• Summary: This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other comple

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT688650	hsa-miR-562	HITS-CLIP	23313552
MIRT688649	hsa-miR-4759	HITS-CLIP	23313552
MIRT688648	hsa-miR-3169	HITS-CLIP	23313552
MIRT688647	hsa-miR-8083	HITS-CLIP	23313552
MIRT688646	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT688645	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT688644	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT688643	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT688642	hsa-miR-1976	HITS-CLIP	23313552
MIRT688641	hsa-miR-4312	HITS-CLIP	23313552
MIRT688640	hsa-miR-1288-3p	HITS-CLIP	23313552
MIRT688639	hsa-miR-30a-5p	HITS-CLIP	23313552
MIRT688638	hsa-miR-30b-5p	HITS-CLIP	23313552
MIRT688637	hsa-miR-30c-5p	HITS-CLIP	23313552
MIRT688636	hsa-miR-30d-5p	HITS-CLIP	23313552
MIRT688635	hsa-miR-30e-5p	HITS-CLIP	23313552
MIRT688634	hsa-miR-3117-3p	HITS-CLIP	23313552
MIRT439169	hsa-let-7c-5p	3'LIFE	25074381
MIRT439169	hsa-let-7c-5p	3'LIFE	25074381
MIRT688650	hsa-miR-562	HITS-CLIP	23313552
MIRT688649	hsa-miR-4759	HITS-CLIP	23313552
MIRT688648	hsa-miR-3169	HITS-CLIP	23313552
MIRT688647	hsa-miR-8083	HITS-CLIP	23313552
MIRT688646	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT688645	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT688644	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT688643	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT688642	hsa-miR-1976	HITS-CLIP	23313552
MIRT688641	hsa-miR-4312	HITS-CLIP	23313552
MIRT688640	hsa-miR-1288-3p	HITS-CLIP	23313552
MIRT688639	hsa-miR-30a-5p	HITS-CLIP	23313552
MIRT688638	hsa-miR-30b-5p	HITS-CLIP	23313552
MIRT688637	hsa-miR-30c-5p	HITS-CLIP	23313552
MIRT688636	hsa-miR-30d-5p	HITS-CLIP	23313552
MIRT688635	hsa-miR-30e-5p	HITS-CLIP	23313552
MIRT688634	hsa-miR-3117-3p	HITS-CLIP	23313552
MIRT909498	hsa-miR-3606	CLIP-seq
MIRT909499	hsa-miR-494	CLIP-seq
MIRT909500	hsa-miR-570	CLIP-seq
MIRT909501	hsa-let-7a	CLIP-seq
MIRT909502	hsa-let-7b	CLIP-seq
MIRT909503	hsa-let-7c	CLIP-seq
MIRT909504	hsa-let-7d	CLIP-seq
MIRT909505	hsa-let-7e	CLIP-seq
MIRT909506	hsa-let-7f	CLIP-seq
MIRT909507	hsa-let-7g	CLIP-seq
MIRT909508	hsa-let-7i	CLIP-seq
MIRT909509	hsa-miR-1	CLIP-seq
MIRT909510	hsa-miR-1200	CLIP-seq
MIRT909511	hsa-miR-129-5p	CLIP-seq
MIRT909512	hsa-miR-202	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT909514	hsa-miR-206	CLIP-seq
MIRT909515	hsa-miR-2113	CLIP-seq
MIRT909516	hsa-miR-3074-5p	CLIP-seq
MIRT909517	hsa-miR-3124-3p	CLIP-seq
MIRT909518	hsa-miR-4324	CLIP-seq
MIRT909519	hsa-miR-4458	CLIP-seq
MIRT909520	hsa-miR-4500	CLIP-seq
MIRT909521	hsa-miR-4678	CLIP-seq
MIRT909522	hsa-miR-544b	CLIP-seq
MIRT909523	hsa-miR-613	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq
MIRT909525	hsa-miR-651	CLIP-seq
MIRT909526	hsa-miR-98	CLIP-seq
MIRT1969583	hsa-miR-1273g	CLIP-seq
MIRT1969584	hsa-miR-25	CLIP-seq
MIRT1969585	hsa-miR-32	CLIP-seq
MIRT1969586	hsa-miR-363	CLIP-seq
MIRT1969587	hsa-miR-367	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT1969590	hsa-miR-92a	CLIP-seq
MIRT1969591	hsa-miR-92b	CLIP-seq
MIRT2205731	hsa-miR-548ae	CLIP-seq
MIRT2205732	hsa-miR-548aj	CLIP-seq
MIRT2205733	hsa-miR-548am	CLIP-seq
MIRT2205734	hsa-miR-548x	CLIP-seq
MIRT2508796	hsa-miR-1202	CLIP-seq
MIRT2508797	hsa-miR-1284	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT2508798	hsa-miR-2276	CLIP-seq
MIRT2508799	hsa-miR-299-3p	CLIP-seq
MIRT2508800	hsa-miR-3194-5p	CLIP-seq
MIRT2508801	hsa-miR-3688-5p	CLIP-seq
MIRT2508802	hsa-miR-376a	CLIP-seq
MIRT2508803	hsa-miR-376b	CLIP-seq
MIRT2508804	hsa-miR-376c	CLIP-seq
MIRT2508805	hsa-miR-3972	CLIP-seq
MIRT2508806	hsa-miR-4277	CLIP-seq
MIRT2508807	hsa-miR-4297	CLIP-seq
MIRT2508808	hsa-miR-4300	CLIP-seq
MIRT2508809	hsa-miR-4491	CLIP-seq
MIRT2508810	hsa-miR-4657	CLIP-seq
MIRT2508811	hsa-miR-4786-3p	CLIP-seq
MIRT2508812	hsa-miR-4789-3p	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT2508813	hsa-miR-558	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq
MIRT2508814	hsa-miR-642b	CLIP-seq
MIRT2508815	hsa-miR-920	CLIP-seq
MIRT2508796	hsa-miR-1202	CLIP-seq
MIRT2508797	hsa-miR-1284	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT2508800	hsa-miR-3194-5p	CLIP-seq
MIRT2508802	hsa-miR-376a	CLIP-seq
MIRT2508803	hsa-miR-376b	CLIP-seq
MIRT2508805	hsa-miR-3972	CLIP-seq
MIRT2508806	hsa-miR-4277	CLIP-seq
MIRT2508807	hsa-miR-4297	CLIP-seq
MIRT2508811	hsa-miR-4786-3p	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOS	Activation	21757709
JUN	Activation	21757709
SP1	Activation	21757709

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12626549
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	16899810
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	12626549
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	7916662
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	10373550, 21976679, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8206879
GO:0005634	Component	Nucleus	TAS	7916662
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	8206879
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	7916662
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006687	Process	Glycosphingolipid metabolic process	IEA
GO:0007165	Process	Signal transduction	TAS	7916662
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008140	Function	CAMP response element binding protein binding	NAS	8206879
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0141156	Process	CAMP/PKA signal transduction	IBA
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 123812
• HGNC: 2352
• e!Ensembl: ENSG00000095794

Protein

• UniProt ID: Q03060
• Protein name: cAMP-responsive element modulator (Inducible cAMP early repressor) (ICER)
• Protein function: Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in sperm
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02173	pKID	98 → 140	pKID domain	Family
  PF00170	bZIP_1	284 → 344	bZIP transcription factor	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Expressed in testes (round spermatids) (at protein level). Isoform 14 is the major activator form in testes. {ECO:0000269|PubMed:11044457, ECO:0000269|PubMed:14511788, ECO:0000269|PubMed:16143638}.
• Sequence:

  MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQL
  PSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPS
  YRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQI
  SNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAP
  SHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAA
  KECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY

• Sequence length: 345

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHLORACNE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	24086717		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	12555239		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	12555239		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28526353, 28784605, 29802206, 29881975, 30026696, 31475302		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	19201103		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24667640		★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	24943041		★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	32970137	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27993161	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31139520		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34251595, 35165059	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	9826119		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31537367		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	28281318	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28710075		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28710075		★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	30219084, 31139520		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23388545	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25794514		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28526353, 29881975		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007, 28067908		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	35315363	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	17374397		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	24672804		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24672804		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17509149, 22552298, 27840176		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16498408		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	CTD_human_DG	25381014		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	16049320		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36980858	Associate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	32970137	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30212560	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28526353, 29881975		★☆☆☆☆ Found in Text Mining only
Histiocytoma Angiomatoid Fibrous	Angiomatoid fibrous histiocytoma	Pubtator	34821426	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	29788195, 31139520		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16049320, 16498408, 22509362		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28440211		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	21507395, 33786731, 9531892	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22019623, 30228239		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919, 28067908		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	26601115	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	23019580, 24297179, 31653682		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11238674, 12370343, 12626549, 15322221, 16237091, 26601115	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	23019580, 24297179, 31653682		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12370343, 15204092, 15322221, 15841182, 17211988, 19299714, 21097497, 21757709, 21976679, 22025620, 22942433, 23019580, 23124208, 23491535, 24047902, 24297179, 30150402, 31653682		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15841182, 17211988		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	26601115	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	23019580, 24297179, 31653682		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	22386572, 30216769		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11507053		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28710075		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25794514		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22488648, 23637631		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22386572		★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	CTD_human_DG	25381014		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	19027736		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	11507053, 12039695, 23929392, 28009602, 29788195, 29975250, 30397348, 31595523		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11094064		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21998402, 27900262		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	21507395		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	18460422		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	12555239, 15048659		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18202121		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	36083250	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11507053		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11507053		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28072703	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	34261344	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	30219084, 34228212, 34715942	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22198373		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	31778615		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23929392		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	30212560	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	12039695		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	22386572		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	33388092	Associate	★☆☆☆☆ Found in Text Mining only