Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	53336
Gene name	CPX chromosome region candidate 1
Gene symbol	CPXCR1
Synonyms (NCBI Gene)	CT77
Chromosome	X
Chromosome location	Xq21.31
Summary	This gene is one of several genes identified in a region of the X chromosome associated with an X-linked cleft palate (CPX) disorder. The encoded protein contains a motif similar to a motif found in zinc-finger proteins. Mutation analysis of this gene has

7 Show/Hide all (7)

miRTarBase ID	miRNA	Experiments
MIRT907806	hsa-miR-4434	CLIP-seq
MIRT907807	hsa-miR-4516	CLIP-seq
MIRT907808	hsa-miR-4531	CLIP-seq
MIRT907809	hsa-miR-4802-5p	CLIP-seq
MIRT739456	hsa-miR-139-5p	CLIP-seq
MIRT739458	hsa-miR-338-5p	CLIP-seq
MIRT739457	hsa-miR-4699-3p	CLIP-seq

MIM	HGNC	e!Ensembl
301055	2332	ENSG00000147183

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8N123
Protein name	CPX chromosomal region candidate gene 1 protein (Cancer/testis antigen 77) (CT77)
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed in a variety of fetal tissues. {ECO:0000269\|PubMed:11499681}.
Sequence	MSYPTKEGSDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATSQE DVVPQAAENSELETEIQKDQREEDLKEELLLLQTPIPRKLVSHKPLNDRSRSHSGKVEMK ANNFPINHKTRFRLSTSWRVPFINSHEIRSMILHLLCDRYFSQAAGCQNTMWVKRKYIAC LYHPNSFTHHERAITFRRPSRVHYYRPLTERMTSGKFCKSTDTKGKCRFRAIVRSVLFVS QIQIESIFNIKGFVDILTYIHTMNVMITNTNNGWKYFCPICGRLFNTYSELRQHSCSSSG N
Sequence length	301
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANTI-NEUTROPHIL ANTIBODY ASSOCIATED VASCULITIS	—	GWAS catalog	22808956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	35907915	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	39358599	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	39358599	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (6)
Cleft Lip	Cleft lip	Pubtator	28877219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27609023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	21685710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28428959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	28428959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	36982982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with CPXCR1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CPXCR1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CPXCR1 (see Related Genes above), that are NOT already directly curated for CPXCR1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CPXCR1.

CPXCR1 (CPX chromosome region candidate 1)

Bookmark This Gene