CPTP (ceramide-1-phosphate transfer protein)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 80772
• Gene name: Ceramide-1-phosphate transfer protein
• Gene symbol: CPTP
• Synonyms (NCBI Gene): GLTPD1
• Chromosome: 1
• Chromosome location: 1p36.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT129984	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT129995	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT129983	hsa-miR-32-5p	HITS-CLIP	22473208

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005543	Function	Phospholipid binding	IDA	23863933
GO:0005634	Component	Nucleus	IEA
GO:0005640	Component	Nuclear outer membrane	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0010507	Process	Negative regulation of autophagy	IMP	29164996
GO:0016020	Component	Membrane	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IMP	29164996
GO:0035627	Process	Ceramide transport	IBA
GO:0035627	Process	Ceramide transport	TAS
GO:0046836	Process	Glycolipid transport	IDA	23863933
GO:0120009	Process	Intermembrane lipid transfer	IBA
GO:0120009	Process	Intermembrane lipid transfer	IEA
GO:0120013	Function	Lipid transfer activity	IEA
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IMP	29164996
GO:1902387	Function	Ceramide 1-phosphate binding	IBA
GO:1902387	Function	Ceramide 1-phosphate binding	IDA	23863933
GO:1902388	Function	Ceramide 1-phosphate transfer activity	IBA
GO:1902388	Function	Ceramide 1-phosphate transfer activity	IDA	23863933
GO:1902388	Function	Ceramide 1-phosphate transfer activity	TAS
GO:1902389	Process	Ceramide 1-phosphate transport	IDA	23863933

Other IDs

• MIM: 615467
• HGNC: 28116
• e!Ensembl: ENSG00000224051

Protein

• UniProt ID: Q5TA50
• Protein name: Ceramide-1-phosphate transfer protein (CPTP) (Glycolipid transfer protein domain-containing protein 1) (GLTP domain-containing protein 1)
• Protein function: Mediates the intracellular transfer of ceramide-1-phosphate (C1P) between organelle membranes and the cell membrane. Required for normal structure of the Golgi stacks. Can bind phosphoceramides with a variety of aliphatic chains, but has a prefe
• PDB: 4K80 , 4K84 , 4K85 , 4K8N , 4KBS , 4KF6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08718	GLTP	27 → 177	Glycolipid transfer protein (GLTP)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. {ECO:0000269|PubMed:23863933}.
• Sequence:

  MDDSETGFNLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSK
  LRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQL
  FLEGLRTSPEDARTSALCADSYNASLAAYHPWVVRRAVTVAFCTLPTREVFLEAMNVGPP
  EQAVQMLGEALPFIQRVYNVSQKLYAEHSLLDLP

• Sequence length: 214

Pathways

Reactome Pathway:

Glycosphingolipid metabolism

Related Genes

No strongly related genes found yet for CPTP.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CPTP.