CPLANE2 (ciliogenesis and planar polarity effector complex subunit 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79363
• Gene name: Ciliogenesis and planar polarity effector complex subunit 2
• Gene symbol: CPLANE2
• Synonyms (NCBI Gene): C1orf89, RSG1
• Chromosome: 1
• Chromosome location: 1p36.13

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003274	Process	Endocardial cushion fusion	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183, 33961781, 35427153
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005814	Component	Centriole	IDA	29038301
GO:0005814	Component	Centriole	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0006887	Process	Exocytosis	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0008104	Process	Intracellular protein localization	ISS
GO:0008589	Process	Regulation of smoothened signaling pathway	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016485	Process	Protein processing	IEA
GO:0017157	Process	Regulation of exocytosis	ISS
GO:0030030	Process	Cell projection organization	IEA
GO:0031338	Process	Regulation of vesicle fusion	ISS
GO:0035082	Process	Axoneme assembly	IEA
GO:0035869	Component	Ciliary transition zone	IDA	29038301
GO:0035869	Component	Ciliary transition zone	IEA
GO:0036064	Component	Ciliary basal body	IDA	29038301
GO:0036064	Component	Ciliary basal body	ISS
GO:0042995	Component	Cell projection	IEA
GO:0060173	Process	Limb development	IEA
GO:0060271	Process	Cilium assembly	IEA
GO:0060271	Process	Cilium assembly	ISS
GO:0097546	Component	Ciliary base	IEA
GO:1904888	Process	Cranial skeletal system development	IEA

Other IDs

• MIM: 620487
• HGNC: 28127
• e!Ensembl: ENSG00000132881

Protein

• UniProt ID: Q9BU20
• Protein name: Ciliogenesis and planar polarity effector 2 (REM2- and Rab-like small GTPase 1)
• Protein function: Required for efficient primary cilia initiation, regulating a late step in cilia initiation. Plays a role in the final maturation of the mother centriole and ciliary vesicle that allows extension of the ciliary axoneme. {ECO:0000250|UniProtKB:A2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	57 → 207	Ras family	Domain

• Sequence:

  MARPPVPGSVVVPNWHESAEGKEYLACILRKNRRRVFGLLERPVLLPPVSIDTASYKIFV
  SGKSGVGKTALVAKLAGLEVPVVHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGES
  ALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGSKFDQY
  MHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADVAHILNGLAEQLWH
  QDQVAAGLLPNPPESAPE

• Sequence length: 258

Related Genes

No strongly related genes found yet for CPLANE2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CPLANE2.